SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|259360|gm1.21250_g from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|259360|gm1.21250_g
Domain Number 1 Region: 9-135
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000000303
Family Ricin B-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|259360|gm1.21250_g
Sequence length 137
Sequence
MSVTLKRHPDTIFKLQSVAHPTHYLQVKDGSSEHGAELIVGPEVPGSKRHLWQFRVDTES
IQNVETGTYAVWNESGAICSKTPQAWKIHEHDDGHHSFQVAGQDVFATATSDSGSIKTHA
TTKSSSHPGQKWKIVVV
Download sequence
Identical sequences A0A0C9VJX2
jgi|Sphst1|259360|gm1.21250_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]