SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|68522|estExt_fgenesh1_pg.C_680047 from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|68522|estExt_fgenesh1_pg.C_680047
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.44e-19
Family Ricin B-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|68522|estExt_fgenesh1_pg.C_680047
Sequence length 142
Sequence
MSLQPGTYNIINAKSGTALDLNDSEIDPIAGHPSHGGESQKWCLEQIFASQWTIRNVQSG
GYLHVEGNEDGTSVTLSDVPFGWDIKPEQADPNEVRIYIPDTSTPINVDLADFGSTTSGT
PVVIFKKWDGKNQIWRLQQVEI
Download sequence
Identical sequences A0A0C9VQR0
jgi|Sphst1|68522|estExt_fgenesh1_pg.C_680047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]