SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Sphst1|69920|estExt_fgenesh1_pg.C_1120031 from Sphaerobolus stellatus v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Sphst1|69920|estExt_fgenesh1_pg.C_1120031
Domain Number 1 Region: 6-141
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.1e-19
Family Ricin B-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Sphst1|69920|estExt_fgenesh1_pg.C_1120031
Sequence length 142
Sequence
MSLQPGTYNIINAKSGTALDLNDSEIDPIAGHPSHGGESQKWCLEQIFASQWTIRNVQSG
GYLRVEGNEDGTSVTLSDVPFGWDIKPEQADPNEVRIYIPDTSTPINVDLADFGSTTSGT
PVVIFKKWDGKNQIWRLQQVEI
Download sequence
Identical sequences A0A0C9VDC1
jgi|Sphst1|69920|estExt_fgenesh1_pg.C_1120031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]