SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338731762|ref|YP_004662881.1| from Simkania negevensis Z

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|338731762|ref|YP_004662881.1|
Domain Number 1 Region: 2-192
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.47e-21
Family DNA/RNA non-specific endonuclease 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|338731762|ref|YP_004662881.1|
Sequence length 205
Comment nuclease EXOG [Simkania negevensis Z]
Sequence
MKQPGWVLQVINANSFPSPPDVVLQEYHPDPKIPLREQASVADYSDNQWVIGNFLFPFDP
EEKLFSDENFSDMFLFSVTSPQDHGFHQGYWKILRGRVEKFAKAKDIGFVGYNVAVLSGP
LFLKAPSERAFMGNNHVPVPTHFFQVIFPTANPEDIEVYVVPNENIEISKPLNDFKVSLQ
EFEKLSSIKDAKGVVGRLIRPAXFL
Download sequence
Identical sequences F8L2P9
gi|338731762|ref|YP_004662881.1|NC_015710 gi|338731762|ref|YP_004662881.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]