SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338731765|ref|YP_004662884.1| from Simkania negevensis Z

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338731765|ref|YP_004662884.1|
Domain Number - Region: 440-551
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000359
Family HNH-motif 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338731765|ref|YP_004662884.1|
Sequence length 562
Comment hypothetical protein SNE_B23890 [Simkania negevensis Z]
Sequence
MQKLPDRLCNLLVQEWRFKVKNFRFLLLFCLPAFLLSPIPSYTFESKTYHHETGEKLFIP
RDENGLINPWGYFSPRSILTYLDGYVDHVFGFIDLLTNVDFLESLCDEEAQRLIDFTIFI
VRFSIPKSRPDLAEKYEQEIEELLDLLYEDVDDEEEYQLSSNHDLHWECLPAVCYEKPEF
LLCKKKKDKGWFERKWHHFTHWVDKNKVPLIMGGATIGVLAIGYVLGGVGASVAAAAVGG
GIVNALEEADTSPPYINKPGEVSFRGEPPEYISPPSHINKPGNVGFCDDGQHHLPTSLSN
PNDPIFPHEGSQDSEQDLSMDLPEFGLDYEELLEEVERVKEEALEATLSEPSDDTAREIA
RDFAVERLHESLGSILAIIEEFKQEPELKAGEFITPTGPSKTVSKVGELASRALGLAAQS
ATAIGTAATTSSIIDGRSSIPMTVVNDNIGWKVGDPINNRTRSGNIPTWNTVRYRYWRNE
ALDVKNGVITRALERKCYEPTSENVKRMERGLAPQRLNKDTGLMESVELHHEPPQRIGGL
FDVTPVTPDEHAGIDPSRKIGG
Download sequence
Identical sequences F8L2Q2
gi|338731765|ref|YP_004662884.1| gi|338731765|ref|YP_004662884.1|NC_015710 WP_013934982.1.32353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]