SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|338731776|ref|YP_004662895.1| from Simkania negevensis Z

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|338731776|ref|YP_004662895.1|
Domain Number - Region: 37-145
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000106
Family HNH-motif 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|338731776|ref|YP_004662895.1|
Sequence length 310
Comment hypothetical protein SNE_B24000 [Simkania negevensis Z]
Sequence
MSKVGELASRALGLVAQSASAIGTAATTSSIIDGRSSIPMTQANDTIGWKVGDPINNRTR
SGNVPTWNTVRYRYWRNEALEVKSGIITKALENKCYEPNKENLSRMERGLAPQRINADTG
RMESVELHHNPAQRDGGLKEIFGLDRFPIKDKETLIFSIEKTNSKFTQGFAIGVFDGYVK
VNGIKTNNRRFSKHLFWEDSTILDVKNIEIKIFTKGDHITICNIWEIEVTGYWGTRLKGW
GKGTEEGFFEYEKPKKATCYYDNHYYRSSKGFGAAMYSDDIPNGKRYFCNDGDEDDDFDD
IIFTVTRAAN
Download sequence
Identical sequences F8L2R3
gi|338731776|ref|YP_004662895.1| gi|338731776|ref|YP_004662895.1|NC_015710 WP_013934993.1.32353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]