SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325958110|ref|YP_004289576.1| from Methanobacterium sp. AL-21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325958110|ref|YP_004289576.1|
Domain Number 1 Region: 3-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 9.42e-123
Family Methyl-coenzyme M reductase gamma chain 0.000000000973
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325958110|ref|YP_004289576.1|
Sequence length 249
Comment methyl-coenzyme M reductase subunit gamma [Methanobacterium sp. AL-21]
Sequence
MAQYYPGTTKVAQNRRNLCNPDYDLEKLREISDEDVVKILGHRAPGEEYPSVHPPLEEMD
EPEDAIREMVEPVDGAKAGDRVRYIQFADSMYFAPAQPFARSRAYLCRYRGSDAGTLSGR
QIIEARERDLEKISKELLETEFFDPARTGIRGKSVHGHSLRLDEDGMMFDMVRRQVLNKA
TGNVEMVKNQIGDELDEPVILGEPLEEAVLKEKTTIYRKDGEAYKDDTDAVEVLHRIHVT
RSNGGYGPE
Download sequence
Identical sequences F0T8R2
gi|325958110|ref|YP_004289576.1| WP_013643955.1.76405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]