SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325960000|ref|YP_004291466.1| from Methanobacterium sp. AL-21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325960000|ref|YP_004291466.1|
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.1e-124
Family Methyl-coenzyme M reductase gamma chain 0.0000000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325960000|ref|YP_004291466.1|
Sequence length 264
Comment methyl-coenzyme M reductase subunit gamma [Methanobacterium sp. AL-21]
Sequence
MSYEVQYTPGNTKIAENRRKHMDPDFELKKIREIADEDIVKILGHRNPGEGYKSVHPPLE
EMDFEEDLMKEMVEPIEGAKEGNRTRYVQFTDSMYNAPAQPYDRARTYMWRFRGVDTGTL
SGRQVIEIRERDLEKISKTLVETELFDPAKTGIRGATVHGHSLRLDENGLMFDALQRYVF
DEKTGSVSYIKDQVGRPLDEPVDMGAPLDEENLKEITTIYRSDNISMRDDPEAIETVEAI
HAARTDGGFGLEVFKDDLKRKLGE
Download sequence
Identical sequences F0TCV4
WP_013645845.1.76405 gi|325960000|ref|YP_004291466.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]