SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310826027|ref|YP_003958384.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310826027|ref|YP_003958384.1|
Domain Number 1 Region: 868-987
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.09e-19
Family Alpha-toxin, C-terminal domain 0.027
Further Details:      
 
Domain Number 2 Region: 998-1109
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.59e-19
Family Alpha-toxin, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 1121-1238
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 3.45e-18
Family Lipoxigenase N-terminal domain 0.055
Further Details:      
 
Domain Number 4 Region: 273-330
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000118
Family Type I dockerin domain 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|310826027|ref|YP_003958384.1|
Domain Number - Region: 767-860
Classification Level Classification E-value
Superfamily Perfringolysin 0.0144
Family Perfringolysin 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|310826027|ref|YP_003958384.1|
Sequence length 1242
Comment hypothetical protein [Eubacterium limosum KIST612]
Sequence
MLKKICSVLVTASLVLSQTAAFAQTQNTAETPGSVTVKENGPKEEKRYVSYGGHLWEVVE
QVDGRLLLCTDPAIDKKLEMDQALIEKDAEAQYQFLNQDFLESFNAVEKAHLDKVTLQKK
TTEDAQKARGAKAVKVFLPNDDTVEILDADVQKALEKFKAGQKTEAPEAAPVPSVAIPEA
LEEAPAPSVATPEALEEAPAPSVATPEAPEPAPVPSVAIPEAPEPAPAPSVATPEAPEPA
PAPSVAIPEAPEPAPAPGVEPPKVNQPEETEEAILGDVNADMKVDILDAQLIALSCAAGG
EMEASRKARGDVNGDAQVNIIDAQQIAQNAVEPLDEGMGTKKMVSARAASVMKSSALESQ
HFAAPDTRPEGLAFGILVNPEGLEQSGAGTKEDPYTFSEKKAAPTPAVPNKVPEQPEVSE
APETTLPFTPFSKEELENPRLNNVEQAFDQLSTAGYKTREPSAAGFPSDLITTTKNHIQG
LGYYGDYTIINVNGDGSPGKIFIYDQGGMVQTLVPPQTKSFHTSGMQVVGDMLIMMNGLH
GDPDSYILMVDLRPLKEGQEAVMLPRETGPSMTGACVGATNYTAADGTERLILIGVRNQC
FESVIPEDGVSFNWVERQYDGPNLKENQNIALVTDVNNQVYLVAFASEASQQGSITDLID
TNGFDGLNFDDRLELYKVDVHSNPNGIKVEFLKRKDVQAYDDDMLVFGSHFRYGATLTVD
SPEGFSVHTTRRAPGNAHFNILGSLGSDVISALFGGNTLPITTYTAGQSYFLENKSGTVS
KMDVTYVTKEGEQKTQTTNNVALGENQDIRIPIDAKDIRLDFYVSTGSSWKPVKTLEYKE
ANGNARRYKITGTVFNPTLHEGVVLGEGIQYQIKVKTGTAFGAGTDSDVYIRLVGDQGTT
DEVLLNYGMTNQFNTRGNPFETKGYDVGVFNFNQDVGKIKRIEVRTDRSGAGADWLLDAI
EVVPMYNTTETQTKKFDIHQWIVNDTWTSFSNTAEDSSQYRLKINTGNVKGAGTDSDIYV
KLTGTKGETNEVEVSGLYNGNAFEKGTSHSVVASFDQNVGEIQKITVRSDMSGVGADWFL
DSVQVVPVWNNQTQDGEKTFDCKEWIVNKNPHTYSLDQNAITRYRMTVKTGKLSWWPKGE
GTDADIYVRLIGDKGQTNEVEITSLIPGNALERGDTDTFTVNFENAIGNVKKIQVRSDMS
GVGPDWYLERIDVQPLFGNKDVGKNVRFAFNQWIDIKKVYEK
Download sequence
Identical sequences A0A1E7RX49 A0A1M7F669 E3GID6
gi|310826027|ref|YP_003958384.1| WP_013378743.1.44369 WP_013378743.1.80573 WP_013378743.1.85847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]