SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|310826025|ref|YP_003958382.1| from Eubacterium limosum KIST612

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|310826025|ref|YP_003958382.1|
Domain Number 1 Region: 2227-2287
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000034
Family Type I dockerin domain 0.005
Further Details:      
 
Domain Number 2 Region: 657-726
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000431
Family Fibronectin type III 0.0034
Further Details:      
 
Weak hits

Sequence:  gi|310826025|ref|YP_003958382.1|
Domain Number - Region: 94-170,245-273
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000132
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number - Region: 1136-1218,1588-1667
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00802
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|310826025|ref|YP_003958382.1|
Sequence length 2292
Comment endo-1-4-beta-xylanase precursor [Eubacterium limosum KIST612]
Sequence
MKKKMRTKEIPQKVAAGVMSGVMLLSSTGATALAQEIQGTELFKGDDAKQTAKGIVKTAA
QSAPTLASRTDTTVTLNSEAELYYAYTEANKAPSEYTWTKASGDTVTISGLTAGTSYDFV
CAADNQGTGMSPASTIYTLQAAPADPENCAVVTYPEETITINAGYEMNTQKDFNGDQVAN
GASISAFIGKNLYVRAAKNGEIPAGVAAAYAIDARPENTTSVPADQITRSTTGFHFTPNP
QGVYQYTGGGQTTPKTIVGGKVTGLQPGTVYSLIDYTAATVNAFKSGTNTQEIRTKSVVA
PATKDGPGQSDLANTVKADKTEADLGETITYTVTYGEGYTPSMTIGGDERAFDTAAVDPE
TKTAVFQYTVKEGDTTVNAVAHFNERAVKGVDAQAPKTLYANDPSNQSAQALAESLPKKV
GVTYDNQTKGEEDASWQLKKESAWNIKGGDYTYEAQVGEARAAQDVKVLPVVAAFEPIGD
IKLPVKTGGYTAKELGLISSIEVTYTSTGFETQTDKAVPVVWSPAVPSGFGANQTDRATF
TGTVSVPEWATIPDPTLSREVTFGIPVTVSGLVFYDKPYDGTDTASWNVNDIDKMSLKVN
GTTLQGYALKKDGSATIHLDSPNVGKRTIAGVSDLSITGPEADQYVLDFSGMTATITKQT
NVTAPDAVTVASDSVTDTSAAVSVTNPAEGYLLEYASAEAGQQPTIWQTSGTFTGLKPGT
AYDFYARYAETSNNAASEATKTATSTKTNAQVAAPTKAGAGKKDPACTITADVKHAAKGE
TVTYTVKPSENFSVDENTSLKINGQAVQMTASGQPDEKGLSTYTAQYTVTENDTVIQAEA
TFNKRAVKTVTAPDAITTTANDPINASQQALEQSLPQTLEVTYDNGVTGQELVQWAKKSG
SPDWDAKGKSYTYTGTLFSDKSKTAEITVTIKAVTATIPPIPEKTIAIREKAYTMEELGL
GSTFEVSFDNSVAPMDCPVSWDPNTPGDFGTTGSKETSKTFAGTVTLPAWATAPSAGTTV
DATVKTATQLTVTGITVTPKAYDGTTEATLVLDGAQLAGTIAPGDTVEFNTNANLTAEFD
NANVGTDKKVTVTGDALTGANAANYIIDWSACDIKGKITKATGITAPAAPEVDAEKTTST
SVTLKEVDITDPTAVAAGARVQYSKDQVNWQQSPVFTGLEPGTAYAFYARVGATGNTEAS
ASSAASPTITTKVAVVAPVLSVDGDCTAGQACKVELYDAENKKINDLLEADAGTKVTYKI
TYCDSHTMHFTFKGNELALSTTTDGMRKAADEKRTWYYDYTIHPGDTTVTASAEAVPKTV
ENFAAAPITMAANDARNQSPEELLKSLPKTIQFQYDNETEGTDRVENWKLKSGAWALKGA
DLTYEGTLKNHPKTKVTQSVTVKPVNATVETTVGKITLKERPQGYTLADLEGEGLPMTAS
IGYDSYVDPADKTTAITWQLPEDFGKTSGAVDITGSVQLPQWATAATSEVLSAHFDITAR
PQVKLEIQADDVTKTYDGSAVLENVPVKLDPASLDAAHKDVALSAETATIRFQTPNVGTG
LTYTVEGLTLTGADADWYALGATYKNGVIVKAAVAAPAAPEADSISLNSIALKPVVLEGA
AKAAGAKVVYQISKDNGTTYTDNPADKYSPVFKNLESGKAYSFKASVEATANTEASEASA
GLTIRTKFNPVAPIIAKTSPCEGGECKVEMTDAQGAPMTVKSEVGTGDVIHYTITSCDNH
TPGKLLINSKTEVPLSGTGKVRTGFYTVTAQDSQLVSQVTFNDRQAVRVESPEPIEMYAN
DDRNQSAESLANSLSKEVAVVYDNGTRGTETIRKWNPSGTAWNPRGGSYTYVAAVGGDGQ
FFTLQNVTVKPVSAVYEPFADTTLTVREEPYAKEELGLSDTLAVTYTSEDGVVKETRDEP
LVWTPEVPGDFGTTETTQTFTARLALPAYAGGDKALSKTIRVSEKSPLVIKGVKAEDKVY
DGTTDAALDFSQATFTGDPGFGSYTVDWEQATGTFEDASAGDHKKVTVEGIVLSGKDADH
YILSVEQVSANIQKAEIKGVVFESARFPEDGKPHSLEAVYPEGCGITGVSYTYEKDGVKT
TEAPKEAGVYKVTATFTVDDNHLAPAPMTATMTIGEAGGTVEEAVVEGLPEGVTGCTVTA
DKDHVTEAGETVTYTLTRNRERKSYVPAVMTVNGQALPLTYDQESGQFKAAYVAEDPTIS
IAAAVQYVLLGSFTGDDTIDIIDAQKIALFLTAGETPSERQKAAGDVNFDGKVDIIDAQQ
IALYLADPEKQF
Download sequence
Identical sequences A0A1E7RX22 A0A1M7F5D1 E3GID4
WP_013378741.1.44369 WP_013378741.1.80573 WP_013378741.1.85847 gi|310826025|ref|YP_003958382.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]