SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328952307|ref|YP_004369641.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328952307|ref|YP_004369641.1|
Domain Number 1 Region: 16-242
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-52
Family ABC transporter ATPase domain-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328952307|ref|YP_004369641.1|
Sequence length 259
Comment phosphate-transporting ATPase [Desulfobacca acetoxidans DSM 11109]
Sequence
MATQPSNNLILSAVAKNLTVDFVGRRVLHGVHLELHPGQLTVIIGRSGSGKTTLLRTFNR
LNEHYPACASSGTLKLHFQDGWQDIYQDGINLAELRQRVGMVFQNPTILPFSVEKNISLL
LKLILNLPRSELEGRVESALRQVHLWSEVKNRLRTPAAVLSGGQQQRLCLARTLALEPEF
LLLDEPTANLDFRIAQKIEELLLELKTRCQIVAVSHSLNQARRLADQLLVLKNGSLMSTL
SPAEFQQPERWQDLLTEMF
Download sequence
Identical sequences F2NG47
WP_013705573.1.50338 gi|328952307|ref|YP_004369641.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]