SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328952448|ref|YP_004369782.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328952448|ref|YP_004369782.1|
Domain Number 1 Region: 283-404,741-848
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6e-19
Family ABC transporter ATPase domain-like 0.035
Further Details:      
 
Domain Number 2 Region: 16-243
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000051
Family PHP domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|328952448|ref|YP_004369782.1|
Sequence length 884
Comment hypothetical protein Desac_0721 [Desulfobacca acetoxidans DSM 11109]
Sequence
MPLDKQAKPFFSHGSRWLRADFHLHTRADREFCYTGEDSYYFSSYIQGLKKTEIRIGVIT
NHNKFDLAEFNSLRQTAKRENIFLLPGVEHSVGDGANGIHTLIVFSDEWLENGQDYINQF
LNVAFQGRTPQEYENANGRSSLSLIDTIKKLEGYQRDFFLVFAHVEERSGLWHELDGGRM
QELGENEFFRRRSLAFQKVRTHDISDRKCRIKVRAWLGEAYPAEVEGSDCKSIDQIGQGG
CCYLKIGSFTFAAVKYALLDHANRLSGELNRHDSSHILSATFDGGVLDGKTIYFSPELNT
LIGIRGSGKSSILEAMRYGLDIPFGEKALDQDYKRFLVDHVLGSGGKVTIQAVDRRGQRY
EVRRICRERPDVYVEGILQPGISIRETILHKPIYFGQKDLSSTGEGFEKDLVEKLVGEKL
TGIRSKIEAQRQKVSDTINQLERLANVAEKKEEYESKKRDAEFRLKFYKDHGVEEKLQKQ
VDFDADSRKCHHVISLVKDYLAGLEEFINRYEDDLKNECIYTSRQNTVFFDAFFVNYKKL
IAGFLQIKEVLADGKKTLSELQEKFKEFEILKDGLKEEFAEIERKLFEEFKGSGAKAIRP
DEFRQLRKTVDQAKQMLEALNKQEDQRIIFNLELLQELATLNNLWLEEYQAVQAELGKVN
RSHSSLKIKAEFKGDKKAFAGFMKDVFGGSRIRQTTFENLAKEFTDFGAIFRELDKAKTI
IGNALVQVFEKYFTENLASLLTWQVPNRFVIKYRDKELKHHSLGQRASALILFILSQQDN
DLIIIDQPEDDLDNQTIYEDVIKLIRTLKPRTQFIFATHNANFPVLGDAEQIISCAYADD
SISITSGSIDCPDMQRKIVDIMEGGEEAFKQRKRIYEIWKPRSS
Download sequence
Identical sequences F2NGI8
WP_013705714.1.50338 gi|328952448|ref|YP_004369782.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]