SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328953426|ref|YP_004370760.1| from Desulfobacca acetoxidans DSM 11109

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328953426|ref|YP_004370760.1|
Domain Number 1 Region: 272-448,590-687,750-830
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.58e-24
Family ABC transporter ATPase domain-like 0.03
Further Details:      
 
Domain Number 2 Region: 39-153
Classification Level Classification E-value
Superfamily PHP domain-like 0.00000000133
Family PHP domain 0.014
Further Details:      
 
Weak hits

Sequence:  gi|328953426|ref|YP_004370760.1|
Domain Number - Region: 520-601
Classification Level Classification E-value
Superfamily PhoU-like 0.0523
Family PhoU-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328953426|ref|YP_004370760.1|
Sequence length 884
Comment DNA repair ATPase [Desulfobacca acetoxidans DSM 11109]
Sequence
MAEKYTKARFWKCALQVNSAMYINYRGDAHGMTEDEYNRELLRVCREEEISIIGLADHGN
VDAVDAIRELMAQEGIVVFPGFEIASTEKAHFVCLFPETTSKDQLTRYLGALGLTNPAAG
IWPSNLGGNDLFSKVNELGGIAYAAHCIDDNGVLFRKLQHVWRNPLLKAAQIPGALDDLK
NEEENGYRQILLNRNPDYRRERPIAIINAKDVARPEDLRNPKASCLIKMTRPCFASFKQA
FLDPESRVRLNSDVPEKYYSRIESVKSTGGYLDGLEIDFSEHLNAVIGGRGTGKSTLLEC
IRYALELRPLAKNAQKQHDEIIRENLGKEKGRIELTIRSSAMHGKRFLISRRYGESATVR
DEFGNPSAFSPADVLPRIEIYGQNEIYEIAQNPQGRLRLLNRFLDIDNRQLDQRLEEIAR
KLKDNRKAILQEQENLAQVEDEVSRLPKLQEQVEQFKKLRLDEKLKIIPLLESEKRLSGR
VSEEIENLETAFIGVENNLPDTIFLSDNTLKGLPHESALQSMRTFLDELTRDVRGFVQQT
QEKIAASKDKILGLQETLAASIRVEEEALEKAFREIPSYEGRSGPEIGMQYHTLLKDIER
IRPKEVLLASHNEVKTELSRMRRAFLSELSEARAQRSAQLQRALKKVNRRLTGKLRLTVS
PEADRGPLMEFLNACGLEGVGLKRLAWIEAAEDFSPLKLAEMIRNGVGTLKQPNWGITQS
VAEALVKLPLAKLMEIEELELPDTISIELNVSPAGKENYRPLDKLSTGQQCTAILHILLL
ENLDPLIMDQPEDNLDNAFIADRIVAELRSAKIARQFLFATHNANIPVFGDAEWIGVFQV
VDGHSEIPEELQGAIDLPEIQQKAAEILEGGKSAFIQRKEKYGF
Download sequence
Identical sequences F2ND05
WP_013706689.1.50338 gi|328953426|ref|YP_004370760.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]