SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|100283|fgenesh3_pg.2__181 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|100283|fgenesh3_pg.2__181
Domain Number - Region: 105-171
Classification Level Classification E-value
Superfamily RING/U-box 0.000271
Family Variant RING domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|100283|fgenesh3_pg.2__181
Sequence length 396
Sequence
MFARTRARAPSSVQPSGNVASDFEPAFEVATADTRKHRLYKQARALAVRLSIIDDDDVAF
PRAQDTVNNGSQIDGHGNTHVTNTPESLSVRRQGSVGTHRATGPKCVICTNHIYGDEFRA
PCGDFYHRECIVALFEAAVQDKSLVPLRCCGRRIILASVQQFLSPALVELYHAKDKELGT
LKRVYCANPSCRLFLCAHVRGAFWRWLPHRMKYKCCPDCGTVTCTRLDRQDPPPYLGVGG
EVPPPYWAHLRPPPYPDESVLLLLINARQSPTSVARQPPQRNVTARAAACPSLPRTSVAR
QPPQRNVMACAAAAHPPRPRACAALQPLQRNVMARAAATQELPGAVNCTSSWTYVAGTLK
RFAPRHQKSLADSELPVLATKEVLIPQMNKRTARVE
Download sequence
Identical sequences A0A1X6N3W5 B8NZZ4
jgi|Pospl1|100283|fgenesh3_pg.2__181 104341.JGI100283 XP_002468933.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]