SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|100649|fgenesh3_pg.21__2 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|100649|fgenesh3_pg.21__2
Domain Number 1 Region: 13-76
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000536
Family FHA domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|100649|fgenesh3_pg.21__2
Sequence length 559
Sequence
MDSASPAEPSRVGNIHVSRKHAKITFTKYGNAYITDLKSHHGTYILRPGDTLSKPIKAET
PTVLADGDIVTFGKIVSNDDTIVHPIAARVSLLYGPGPAAATPTHTTPNANEAGLSEEPP
RGTSGRYGIYVSSDESEESSDGGSDVEEIPPPSPPAAARMHRYNLPTFTRPSDCTARMQL
LRQVLPAIQPACIVDLRSVSPDPAPPALPPLESASPALVPALVQQDGQTGGEAARDDGPN
PELSIVDRRDLLRDLPDLSVPPPMYSFPWPLAFSFDANAGACSHAIEGTDFMHDCDSELA
NASESPATQAQDGEEDDTASSEGRSTTPEEQPTMVLTELEAQVNLASNDISTLQMQRRSD
ESRFEEHVRVTKARLAELDEHMQELNGRVTKHVAANDVIMAEATSRVDDLRADINRVHTE
LTDKLVSEERASANHAVELNNVDAMRTMMEDMRSLKNAVETQLARDIEIIKVAHAQTQAA
LQALTAASAQQAETSGTRKRKRLEMNNTEADNETGGESRVAAPLPKRRRTAGRFVKQVVQ
TTTVAAVGAVFAVAALAFV
Download sequence
Identical sequences B8P4E0
jgi|Pospl1|100649|fgenesh3_pg.21__2 XP_002470575.1.31404 104341.JGI100649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]