SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|101173|fgenesh3_pg.9__114 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|101173|fgenesh3_pg.9__114
Domain Number 1 Region: 49-95
Classification Level Classification E-value
Superfamily UBA-like 0.00000000111
Family CUE domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|101173|fgenesh3_pg.9__114
Sequence length 381
Sequence
MSHSAEHLPTYAEGDNGDGHGAVPEFEAHTSEGTPDAALPPVSQPQDEHDEAPQVAALRS
MFPDFDSTVLQSVLESVDYNQDRAIDVLLGMSDPEYVSTAVSPPPEHDLALDEQLARQLA
LEDEQQAPRARGQAWPRRDDVPYEARHRTPGQPQQSQQQQQQQYVTGSERGDFQELQETL
GRMAESGKRTFSSIVSKAKAKINEYNQQNNQPRPGQTSAQPTEQRWDAAPPTQLDRHTAA
EAYSQQYYAQNRESTAPAARETRTPPLIILQDGRSSSNDYRQVTGYDVGPKLDSPLPSAS
ATVRPSSPQNAVNRSSISSARPSGETPQRPLSASGNPIDGAKLGLLPKRAVSLINTSQVP
HKSEEEDELEYVENPFEEGHN
Download sequence
Identical sequences B8P1Y7
jgi|Pospl1|101173|fgenesh3_pg.9__114 104341.JGI101173 XP_002469707.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]