SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|101582|fgenesh3_pg.144__47 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|101582|fgenesh3_pg.144__47
Domain Number 1 Region: 295-418
Classification Level Classification E-value
Superfamily SET domain 0.0000000278
Family Histone lysine methyltransferases 0.035
Further Details:      
 
Domain Number 2 Region: 506-559
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000746
Family FHA domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|101582|fgenesh3_pg.144__47
Sequence length 1200
Sequence
MSFSLRPATTQPTSYDVEHSKDFWYCHNTPAHKLCYRAAYGMRHNATEAAALGLLGLHSS
FDTLSTVPLKAMGESAVNRLDDDEDTSDYINCICGFTYDDGFSIGATPSPAGAMRLASGS
STLSPRPIDRDPAVRTQKARQRAALDLDRQKRRVSNPGVDRRGRRPSAAAIDGGGQSKRR
RRPSINVQPTGEDELVDIDEPWSYSYVSIDKDIIPHNNTRDRLRRAAPQWRGVTALEGES
STATSPTTTPVLLTYDGFPSSSPIHFTPLTRSAFHPALSLSVDPSLRPPSYAVSRSIPSS
SFITPFMSTIIPSTTYLSDPLNAYAHLSMPKPFVHLIGPPLDLALDARQTGNQSRFVRSG
CRPNAVLRAVLCPRIKRSMSAQRVVDDGEPEDEDALTFGIFALRDLKAHEEVMLSWEWDD
GSVIHHLPALINNLHIFPLHQYRQQMMSTLHTLSSTFATCSRGPMTRDCALALMVEPVDS
HTPPTLTPSPRYLHRGADVMWNIPAVARMASIVYDCRVNIFIKDMKSSNGMFSNGKCLSP
ECVESEPFELKSDDIVEFGIDIVGEDNKTITHHKVAARVVCVLTEQEAQAAARAEAQAGP
AAYGVGVPPAAGAFSFAPSQPPNAPGQQRRPSLQQRRPSLQQDLIELGDRGRNMHTPGKS
GLTFDHILSCLQGELQKSHDTGTELHSLTSAMNEIHDTLGGNLPPNLPPHPSNLPPVMPP
QSQQQQQESEQQQPPAAPSSSESGLALSELQSRLRETQMSLASHIDKIRSLETMLAEHEA
IKREVGSLRKLMEERKREMDTSRGRSGSPSGRHHQYGRDDNMAHDQHYMSDDDDDARSVS
TIVPHELDRVDEEDEEQLAAEEEEEQRRRWRDELGCLRTPKPTGMGMSNDDYDHDHDHSR
YKPQQRTWLPSPPPAAAPAPIPAAVPDSISERLTTLSKQLESALELLRSLEAQHSVVQLT
ISLLESKIASLESLMHDTRSQVQVQTEATKQLAEAMRSEQLLDSAAQEAEQRTWESLTEM
VNEWKKNEEWTEERERLRCAKDEWEMCIRVVEDGVGSNISKPTQPVSRVDAPTTEVKTQQ
LIKRPLALAVCLHDCWRGGEDEPTRSLKGIPFPITPESSVLNHPLLSSDDASGTATDSQM
RPPPKDLPHFNLLAAHGHWGSLMADKTRRFGFGIAYITSSSCPGERVIIYYNRGPSYLCV
Download sequence
Identical sequences A0A1X6N3G6 B8PHV0
jgi|Pospl1|101582|fgenesh3_pg.144__47 XP_002475257.1.31404 104341.JGI101582

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]