SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|102843|fgenesh3_pg.79__47 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|102843|fgenesh3_pg.79__47
Domain Number 1 Region: 476-516
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000132
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 2 Region: 352-405
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000174
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|102843|fgenesh3_pg.79__47
Domain Number - Region: 93-139
Classification Level Classification E-value
Superfamily DHH phosphoesterases 0.0262
Family Exonuclease RecJ 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|102843|fgenesh3_pg.79__47
Sequence length 542
Sequence
MNCARIIFELERTGSKNAEFILHLDVDEIHKVPIFRKTLKMITSDFAQSGIEQFKNVLGR
LQDVATKGRSAACAIITRPPEIIACFMIPTEGNGIFVIFDSHPRPNKHPHGAAFILNNSL
SATASYIADLLKYDDRLLSDSTLQWQAQLLAHFSAHIFTSSPTSGSAAELTEATLQASLE
VLSLRARVLDIESQNGYLTADNERLSGEVSRLEDEVAELKAQSQTQIFVQDKSYRNVSRT
FDVARDSQSQKGKGREVYVPHTSTNEVDSKQFIPPRRQIEGSHASSSRRAGSAFYDPMYD
HDFALAAALQAEQMPSQDGAYAASMQREFDGEDARLKAQMTTLKHTAPGIFECGICLEEF
NVDVVARIDICGHQFCRTCILGHTAAKIDERRYPIVCPICMADKGLKKQGDKQYEVFVEM
QLAAFSVILHCRKCKNTVFVDKSEHAATEILKIEFGGPKHSCDGSSELKHLMQQRGWKYC
PGCKTPAEKIDGCNHMTCMSPGCNTHFCYVCGEAITQSALRSEIKSALSAHYRRCRLFED
VA
Download sequence
Identical sequences B8PCF9
XP_002473353.1.31404 jgi|Pospl1|102843|fgenesh3_pg.79__47 104341.JGI102843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]