SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|103022|fgenesh3_pg.28__57 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|103022|fgenesh3_pg.28__57
Domain Number 1 Region: 104-245
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000136
Family Extended AAA-ATPase domain 0.0000267
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|103022|fgenesh3_pg.28__57
Domain Number - Region: 488-524
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00426
Family FHA domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|103022|fgenesh3_pg.28__57
Sequence length 874
Sequence
MSFSLRPAATQPTSYDVKDGRDSQRPDGVHVSVESDKAAGCPCEAKYRALAIRVLVLCFA
IVASQAPSPASVSPADDVDAAHTAHELAAIISLIRLTPLRRNVNIEVEHRVVSQLLTLVN
GLKARSNIVITAATNRPKSIDPALRRFGRFDREIDVGISDPTSRLGILRIQTKNMKLGDD
VDLEQRSQRTPTVTSGQISHLCARRPPQIREKMDLMNLDEDIIDTEVLDSLDITMENFRF
ALSTPTPCCQARHPRKNRVGHPTSAGETSEGRGIMRRVDLGPLVGRERGFRTREQVPLSG
GMTGVEMAPPPRALVVPRLQERQTSEGGRRRFAGRGRAVTQPERQSKTKAALRASSVPPA
HHARDRKGKSGAVPTTLEDKDSAMEIDEKEERMPPKLRKGWIRKSFETLRDVYQRDAGDA
LNVSHNEAGAAGERGRRARRLRGWTWMRLYLTRESSRDIWCSPFVSYLPLMCWARARNYA
DTDPPAPQIFIKDVKCSNGTFIKGERLSPEGVESEPCELKSDDMEFGSIDIVGEDKKTII
HYKVAARVVCVFTEQEAQAAARAEAQAGPAAYGVGAGGGAPPAPGAFSFAPGQPPNAPGQ
QRRPSLQQGLIGLGDRDGNMRAPGKSGLTFDHVLSRLQSELQKSRNTGAELHSLTSVMNE
IHDTLGGNLAARSRRTSLRILRIFHQLCLLNCGNSSKNLNNNSHVDKIRSLETMLAEHEA
IKHEVGSLRELMEEMDMSRRRSGNPSGRHQYGHDDDMAHDQHYMSDDDDNVHSISTIVPH
ELDQVNKEDEEQLAVEEEEEQRRRRREELGCPRTPEPTGMATHSVAVSPACSRASSYSRW
GSEQLLDAAVQEAGQRLRDSLMEMVNEWRKNIEG
Download sequence
Identical sequences B8P5L9
jgi|Pospl1|103022|fgenesh3_pg.28__57 XP_002470961.1.31404 104341.JGI103022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]