SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|103037|fgenesh3_pg.28__72 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|103037|fgenesh3_pg.28__72
Domain Number 1 Region: 97-164
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000778
Family RING finger domain, C3HC4 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|103037|fgenesh3_pg.28__72
Sequence length 221
Sequence
MGPSRRNRHNEGKHPSSSPMPVASTSRALKRSAKGALKLGVDSKLHPGVMKTEDLECRLA
KAKLVRAHLQAEVVEKQAGVKTVERDINELLTLSANLAQSLFQQLVEDYSCPFAYPLTTD
CGHTYCALCVLKPIFTHCDPQSGQWDHNINCPKCSRPLLYNKQDPPGYLPSLPLTSNKTA
AAAINEIFSVITRLCDMDNDNNNANGICKPAWHGWLPGGAT
Download sequence
Identical sequences B8P5M8
jgi|Pospl1|103037|fgenesh3_pg.28__72 XP_002470966.1.31404 104341.JGI103037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]