SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|103042|fgenesh3_pg.28__77 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|103042|fgenesh3_pg.28__77
Domain Number 1 Region: 155-216
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000593
Family FHA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|103042|fgenesh3_pg.28__77
Sequence length 844
Sequence
MLAPSAIACLLPSRSSFSLTLYLSLAVFRVFRNTARNRRRRALRNLGVEITFAWTASATQ
DIHEPRLAAGHVASTPLYTAKQCGSFKLVAFGHHLPGGRVPHAAALLVIQRSFNCVWTHT
GMQARAFKPVRFQLTRHVEIGHQTNAKTVPAECIGYFDFKVLFRQHTEVWEEAAKIFIKD
VKSPNGTFINGERLSPEGVESEPFKLKSDDIEFGGIDIVVKDKKTIIHYKVAARVVCVFT
EQEAQAAACAEAQAGPATYGVGMGGGAPPAVGAFSFTPGQPPNAPRQQRYPSLQQGRIGL
GDRGGNMRAHGKSGLTFDHILSRLQGELQKSRDTGAELHSLTSAMNEIHDTLGGNLPPNL
PPHPSNLPPVMPPQSQQQQQESEQQQAPAAPSPSDSDKIRSLETMLAEHEAIKREVGSLR
ELMEERKREMDTSRGRSGSPSGRRQYGHDDDSHYMSDDDDNVHIDEEDEEQLATEEKRSS
RGSRGKSWVTRACQSQRERRTRSSSPPPAAAPAPIPAAVPDNISKRLTTLSKQLESALEL
SRSLEAQHSVAQSTISLLELKVTSLENLVHDTRSQVQVQTEATEQLAEAMCSKQPPDSAA
QEAEQRTRESLTEMVNEWKKNVEGRWSNVQEKWTEEQEHLRRAKDEWETCIRVVKDGVGS
NVSKVESMLGTLAALLAQQHSFLNGNGKLTHSGGLVTPPSPRSLSAESTHPRQRRKRSSS
SRGRLRSRSASMAASMEVGSSASSISGDTTESYSLTWRRLPWTADDLSISNTELHAASDR
ATTAGEDELTGNLKGMLFPIIPESSVLNHPLSSSDDASGTATNSQMRLPPNDLVYRPVYF
VEMR
Download sequence
Identical sequences B8P5N1
jgi|Pospl1|103042|fgenesh3_pg.28__77 104341.JGI103042 XP_002470968.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]