SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|103123|fgenesh3_pg.83__3 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|103123|fgenesh3_pg.83__3
Domain Number 1 Region: 460-482,528-730
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.01e-26
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 2 Region: 9-34
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000926
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|103123|fgenesh3_pg.83__3
Sequence length 1157
Sequence
MNVPDPPWKQKTRPCPFYSQGRCLFAESCNFLHTAKVQRTEDGLLSTCERSLPSPPESPI
TNARSAMATKFVRFRSPPRSPRLSSLLMALGDVIHQEEEEDNDDVDEEPEASVVSSPEVV
VSEPELAPAEYVPAPIDENVDEDAESTTLVNSAVSSSPMLPDTELDYAYTPRSSSIVPSE
DAYSDDGEVTITQFRDSYASASSGTSGLLSPIEMASAPLTLPQRRISAEVHRGDSFDSGY
ADSCCSIGPVPATFMTSPPQPRSVRLESRLSVLSSPFSSPATRAQMVGIEPRVEVEFFSP
RMQPARTEPQVTVSDEPDHQLDVAGEVPQEQLTVAVAVSSPVEAEPWAASPVMATPAVNA
LYDGYLDDEADELSALPSPFDEPPRPPMAVAAEAVYSLAGDAAATLPPATVDMVARAFEP
VMDIFANCALKVATSDAVVVIDQPTLKRGPSSVPASCSTDASPTSIAWSSDASSLLVSDA
AGIFKYILGDASLAPIYSSPDEEAARGPIRALVSKDRGTNVLFVREQRVHILEIHSKKIA
QTFDSHKSTITSLALSNDASLLATTSASAIHVHNLTHGSHTVLRGISANATISTCSFHAH
SRTRLLVGAGAQLLVCDTTRPSGAVKTIPLSKEKAALGDVVSIASSPFSKTLVAVACSGG
TICLVDLDKEKGICRTVSLHVPLTALVFSPEGATLYAGTENGKVMVQDLRALDKPPRSIT
VSEKGGRVVAMSIQKKSKSEDSTVKTAGMASSKPLVQQDVNKNPTRRAASSTSTDPKAAP
AAKLKVTSPVATRVSSFKSTPVKARMSSYGSPNVMRTRAAAAKSPNARKASNGGVAKKVF
SPPRSTLPRGGAAVPGASEDFNISVRVENLLGLPTTNTAKENINPMQDVPEPTRKADAPD
TISAVSHPSRATSREAGKMRTRTTSTNRTTASSASAVSKRRSLTPSPDLPDVDLDGPVTP
LPASKSKGKGKMAAMGVLGLGTPEVDRWIKAGQLQVAEEGETDKDEGKRVGFASEDDDEV
NEHRERQDRKDTVRESADVNFVVPETAMQVSPRRVHGGPSWTPVPSPLRNLANSHPSSPN
THAAANLLQSLLRDATYDFRQETHGELVGLHLDMLRMGRGLRTEMRSVVDEFRGEMSALR
EENTRLRVENERLRRGY
Download sequence
Identical sequences A0A1X6NAS7 B8PCS1
XP_002473491.1.31404 104341.JGI103123 jgi|Pospl1|103123|fgenesh3_pg.83__3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]