SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|103516|fgenesh3_pg.4__128 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|103516|fgenesh3_pg.4__128
Domain Number 1 Region: 825-894
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000019
Family LIM domain 0.03
Further Details:      
 
Domain Number 2 Region: 926-981
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000004
Family LIM domain 0.026
Further Details:      
 
Domain Number 3 Region: 977-1004
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000299
Family LIM domain 0.016
Further Details:      
 
Domain Number 4 Region: 797-824
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000395
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|103516|fgenesh3_pg.4__128
Sequence length 1011
Sequence
MADNARSTYYTAPVGQPPPQFEYRPQPYPYPSYQQQQAYAQPAQAYPPTTYPSHDQGRYA
YGNPSTARHPLPIPPPSPAPPRPPSAHPPGPQYQPSQQPMSYSPSPFDPRNAHAAAQRSP
AAVPHARRPLPEPRSRPGDAHTSQPPPPRPSPSPGPRAPTHRPTVSVSSLPTVRPSLGTP
TSPHSSPPKSTTSPHQYGLPRSFAQPNLARSPSPSKIDRNEVQQPSLSEIAPMGQKFVPH
WRRALPTPGHPAGSPPVPLQPQQVERRSTVSGPVPPPIAQRQGNAIRPLPQSPAMPGAGH
GRSSSSSVHPLPPLPSAAPQTPAQSNSPPRRLPQPNIPRAARPGSSSTINSGTDSTDSED
LASHVLLSRPQTRPPVNGQRNGRQSPQYGILDMPSRMQSSANGSAEAQSVTLRLASMSVQ
DDQHGQTRDDTVLPNPGEQSSRPPSRTHGYSQSVPNASSVVLPHPMPPMTRTYAQSGATR
WPAGLPPLPKAPASNDGGGDDPSRRPGIFGRSTPTAGHRPPILDLSLDDAPPPSLRRSPS
PARSAAQSAPRHEPPSPFDPYRNAPASRSTGGRPQPASIRTQALNGTSGGPVFSTRHELP
SPSRSRAESPVSATTPSSAVSAASAFTLSAFPRPPSSTPPSSRSSSSPRDPQSAGSAVSP
LSAVSPASANSTSSAFTLSSFPQPPSQVPSDHTFGRRIVGPSDQDRRDGGGFRQAIPKIS
FPASGDDDDSEESDSDFGPVISVSGPGDHEPSIPSISIGPVDDTPDGLPQFSLTDETTKH
PEEHVTPLLRAIRKGPGLTCGGCGGAIVGRTVSAMGARWHPGCFRCCVCNELLEHLSSYE
HEGRAYCGLDYHERFAPRCYHCKTVIVDERFITLDDPELGKRTYHDMHFFCAECGDPFLA
PSASSRAPAGGQTFSGDGIFSGGEDDVGFTVYRGHPYCEACHVRLRLPKCKRCKKAIRDG
KRAVEALGGKWCWECFVCASCERPFDNPAFFQRDGKPFCEHCFSIMIKNEM
Download sequence
Identical sequences B8P0D6
jgi|Pospl1|103516|fgenesh3_pg.4__128 XP_002469176.1.31404 104341.JGI103516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]