SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|104144|fgenesh3_pg.155__25 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|104144|fgenesh3_pg.155__25
Domain Number 1 Region: 7-383
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-111
Family Motor proteins 0.0000000016
Further Details:      
 
Domain Number 2 Region: 1459-1582
Classification Level Classification E-value
Superfamily PH domain-like 1.07e-17
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 
Domain Number 3 Region: 494-578
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000138
Family FHA domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|104144|fgenesh3_pg.155__25
Sequence length 1589
Sequence
MAEHGDGNIKVVVRCRPLNSREIARGAKCLVRMEGNQTILDPPEAGSAGAGRATERKPMN
FAFDKSYWSAGPRDEPNYCSQQTLYDDLGKELLDHGFAGFNACILAYRFWKVIQSLKFSI
LSSSMMGYGADKGIIPLTCSELFTRVEDKKAADPNVSFTVEVSYIEIYNEKVRDLLNPKN
TGNLRVREHPSLGPYVEDLSKLVVSSYDEMMQLMDEGNKARTVAATNMNETSSRSHAVFT
LILTMKRHDVDTNLDTEKVSRISLVDLAGSERANSTGATGQRLKEGANINKSLTTLGKVI
ASLAAASQNEGKKGKKGKMDEFVPYRDSVLTWLLKDSLGGNSKTAMIAAISPADVQYEET
LSTLRYADQAKKIKNKAVVNEDPNAKLVRELKEELEMLRARVSGSSSEAVYDPKIPASQQ
KVTYQAKDGTIKTVTKAALQEQLETSEKLMQGLNETWEEKMQRTQEVQKEREKALEELGI
SIDKNNVGVHTPKKMPHLVNLVGRLDSEKPAAIRLSGESIAEEHCYFEHSDGKVTLHAMP
DAVTFLNGRQITAGQTYKLRTGFRIIMGEHHVFRFNNPEEVRKQRDRLAKSSMHMSITAT
DLQHGGTPGEGHTRPESPASSVELNDVDWTFAKREAAFARLGLDPTLDNLPDEDLNKLFE
KITKVKTMRDHNSKPRPESSLSQADDIWSETGRPAASDAFTDDTSVDAMASHDSPDVGGS
LKEAQNQLETQRIEFESRLQAIAESSEAEDLKIEKEQMEHQLKLVQNHMKRLLDARARGE
IDAELEAFEPIIYTARQLRLIRKTLDKWRAHRSFSMAEVVLSTAVFVKEANIISKELNKD
VSYNFTVASGGSLAAPVSAIDSIAGLDQFGDVVDPVLASATQPSVAVKVLDKRNKAIYAW
SLDRLQQQLQRMRNLTTFIDRPSYSQHFSSEEPFYDSPPPEYSFIGNALLSLAPLSRRLS
STSVVPIFCRYTAEAIGSCRIDVKISNVVFSSKHANASASSTRPPSPVPGTVPPGSKISF
ILTVDSVKGLSHHDFSSAHIQVRLSSFMGPFISSEEVYPSSAIDMDTASLSDLKFRRSFS
IVASSRVLTYLRQGYAPIEFFARLNATYLERMERWDELREQRLPPSTHSPSPDSNSANLP
LMRRSETDFVVEQTHDVVAWLQISELAPDGIYTPVPVISQGNLDPGAFLLHQGLQRRIVL
SLFSNSGRQLPWTEVTRIRIGNIRLLDAKGRLHDASSKALVTLPLLQQQAVDFKMDGTGT
LSAEALWDTSVHNSILLNRVTGSNQRIMLQISWSVNVDVCAEPVQFTMDTAMSIQSRDAR
PPSRFMSLLGATKIIPKTSTVFTVRLTPPLTRSPKDLWRLDTAEKYVRGEETLGVWKPRG
VSVVEDYNKLVSMERRAADVQAVRVVLATSPTSRIMQSDAVVWASEGLMRKALNLWQKKF
GHPGEIVISQDPVDPDESSVMSGKTSGTQSTESIKLMSSTKVVPRNDGPTKKGHMMIMVD
ANENLWEKRWFVLRRPYLHVYAHSNEVEETAIINLSGVNIERNPEMEVLLGKKFTFTLFT
ASNSYALAAPSLKELQAWTSKLDPTRVPS
Download sequence
Identical sequences B8PIH1
104341.JGI104144 XP_002475469.1.31404 jgi|Pospl1|104144|fgenesh3_pg.155__25

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]