SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|104732|fgenesh3_pg.161__28 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|104732|fgenesh3_pg.161__28
Domain Number 1 Region: 303-397
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000523
Family BSD domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|104732|fgenesh3_pg.161__28
Sequence length 537
Sequence
MNFLDGYEITSPPTPPAGQQPEPSLNEEVSQVVGQLSRFWGGFRKQSQTVLEAARKDLGE
VVSQAQKELSKLTEPSEASTSTIAPSGSTETDSSAETDLEKEKDSDADSTPSGEASSSTS
TIFPPDATDQEQQSSTLFSRLQASLPPHIVSAVQENIPDSIRHARGLSLTAPDLAALRST
LTSELQRVQGSSGELLQRGEGLLQRMQGSGGDLLQRVQGGGEELLREAGEFLKEAVRVVP
PEEGGSNASTAVVWDGTDVWMIPTYAEEPASTRAKGKERERSQSTGSGTGSGRQSMDSVR
AATTRAEAMLAQLRHDPKVLRADPAAEGEAFGEWVAELGAEGIESETWLARREKELDERP
ELTALLEALVTEEVNESTFWTRYFFRVHQVEREEERRKALLQRTTENEEDFSWEDDDDEA
TSPTAAKPDATTPSAPVTPATAKPAPTPTVAKLATPTERSRVSTPTSASRRPSSEESYDV
VSSQVSRGGSTSGVESGDKEEADEEEDDEEDNEEEVAAAKPRQDTKAEEEEEESDWE
Download sequence
Identical sequences B8PIW2
jgi|Pospl1|104732|fgenesh3_pg.161__28 104341.JGI104732 XP_002475618.1.31404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]