SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105437|fgenesh3_pg.146__19 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|105437|fgenesh3_pg.146__19
Domain Number - Region: 26-65
Classification Level Classification E-value
Superfamily RING/U-box 0.000244
Family RING finger domain, C3HC4 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105437|fgenesh3_pg.146__19
Sequence length 363
Sequence
MWGPIRCANAVELWALFLLRLSSIDQCLRSTLTEHQQCPKCRQSATEVHMRKNIAVENAV
KAWSAARALVLQLSKEEQDRQNAPPKRTDRSERPRKRRKTAQSSGQSSDSDVKIISGPSS
PVNVKATSSVECPVCRKHVPFDVINQHIDSNCRKFSAGEQSSSKDKNNQKQQWSKVFDKG
GVASSTRRSKEKERYMSKTPDEGYLPKVAYHTLKDKRINDLLNEYDLPTSGDRAACIRRH
EKWVVLYNANIDRTPDSRRTHEQLRRDLRRWEDTLKPTAGSGSNSASGSGSKRAVAADTT
AYQVTHKAQFAQLVEAARPKTAASKPQTNESPDEIGGTQEQDGEPLQVTDSEPVVISDSD
SES
Download sequence
Identical sequences B8PHY9
jgi|Pospl1|105437|fgenesh3_pg.146__19 XP_002475292.1.31404 104341.JGI105437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]