SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105691|fgenesh3_pg.2297__2 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|105691|fgenesh3_pg.2297__2
Domain Number 1 Region: 23-115
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000000181
Family Protein kinases, catalytic subunit 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105691|fgenesh3_pg.2297__2
Sequence length 158
Sequence
MARIKIENRSQALLQQDIAAEQCTMAYRAPELFDVKTGVTLDEKSLGCTLFALAYSHSPF
ENMQTTEQGGSIAMAVMNAQYKHPDSAYSQGLKSLIDSMLKVNPKDRPDIHQFLSLAGLA
VLTDVSGFGVSASVALFAGISEGEASFTLSPSSLLRFF
Download sequence
Identical sequences 104341.JGI105691 jgi|Pospl1|105691|fgenesh3_pg.2297__2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]