SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105693|fgenesh3_pg.10__1 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|105693|fgenesh3_pg.10__1
Domain Number 1 Region: 587-702
Classification Level Classification E-value
Superfamily UBC-like 6.49e-28
Family UBC-related 0.00055
Further Details:      
 
Domain Number 2 Region: 378-537
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000325
Family Integrin A (or I) domain 0.054
Further Details:      
 
Domain Number 3 Region: 196-267
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000698
Family U-box 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105693|fgenesh3_pg.10__1
Sequence length 1006
Sequence
MELQPIIEARKRAGEWDYDAFGTTRTDKVDTRIIEEAIVVTSDPSRSMQQDFNPPDDDIT
RDPDVIAAETCLEHFGKRGITMIDALQSASFDISLEKVMAKSVSNDFSVRILKHDFGIER
LERKKWFGNSRQYTVASIGGSFNEDVQIGGTIEFGRRRWEDIVAIASDQASNSQLVDYLL
EYIDANDQGADFKIPNGRFVDPFSGEIFVDPVRASDGYVYERRWIEAWQNAHGHSPIDPT
IELDLERNLILVQNLSSLIVRFLNGRPRAWFNPTKKPLLIEYPGVFSVQHEYVPLPGAVT
VLSILIDQWMFDSQRQPSTQRFWHGLTHSGDGTMHGTPLDPNLLFHELPTNSTQIGVFQF
NKLELASRRWNYRQRLKSRSMSRLDVAKQAFEALVNKSEAFDHPVGIGLVTFGREVREVQ
TDGDTPLYDSLVVGRSMLERFKAQASSYQILLLTDLTDPMEKNPSAALRIICLTDGEDVG
SRVTAAAVAAQLQRSGIILDSIVVQTSALVNAIHPIAVATGGYSFKVDTVEQALNIVELE
TVLRSKDCVGRFSRGDLSCRRYPWHLSRYNDLSTYPWSFVLAFIDVYTGDDLAFWKSPYE
GGTFLAYYDFGKDYPQAAPEVRFITPILHPNINRHGKVCHAALDKSWLVDISVSTVLQIL
YGILLTPDTDNPLDLHATMEYNDDSGQHALKVHNMVQKFASKTRAEWKKELDNSDYHNNL
NLISQSPEGRIGYDHHRAPNAQTYRVKRMEDARESAADRGIGQLDGTPTSPTALRGDKCA
SHMLTADHPNVARYLDSLARAYHAHMEKLGPSTSRFSKQSPAVCKLGKVESVNAMLGAGS
DLDQQQCECILALAALKTYNNPSHPAHFALWGRSIDERTEALVTKIAYHKPALIELPTGW
FGGSEAIWHLRRHQGLAFPKDRIQRSEEPTKMTLRQRKTASSQCAGHIGPDKPPRARARF
VHVTQEGSEPSEVLQASLLTEVASGIIRAPASAPPTHHIHTKRPQR
Download sequence
Identical sequences B8P210
jgi|Pospl1|105693|fgenesh3_pg.10__1 XP_002469762.1.31404 104341.JGI105693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]