SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|105697|fgenesh3_pg.10__5 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|105697|fgenesh3_pg.10__5
Domain Number 1 Region: 755-802
Classification Level Classification E-value
Superfamily RING/U-box 0.0000194
Family ZZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|105697|fgenesh3_pg.10__5
Sequence length 992
Sequence
MSLLAKVLKGPLWENTFANFVSMFSQRRDDIEFALSIHIAGKVDGLHEKVDDLAQIVERK
TDMILEFLKNYIPPEHTDVCKQIDRRGGREAVLKNDDALQELVSARLEPNSSRPSNQATA
LARNAKHELESQLIDPAFQIQNNTQSFDRKFEMQQRQILEGLASDMERNEHTKGWRGSVK
ARHFVLALRDYEQERREEKMRKEATFQVAPTFDPDAWAFDWITVKRLQAITEALDDDASG
FITVTEANNFTSSRPADWSLPQWLAYWAIGWQISATIYRDKIHEIFEKMFTMRPHLHEAN
VLMVDSYLSAIWTDICGLTTSLEPFYATPQLLERFQSYIDAEEERVKKNLEAIKYHIDDS
TSLALVTGPGRIEKYLFPLIYLLLKHVYDVFRIGRKEIVNDRHNVDAYDNQWTINRAVHD
RIDEMKGDRGKLIRCDQSLMDSSASLTHQRLDLAHHFEHAYSKLYHLTYLRLEDPISTVT
RKAIQAFPYKAVTYDDTEEDKDVPTAETVLSYAYDQSQLYAGVQAMEDTATDEDRKATGK
LKNIYSNVSRLGRWTFYNYTDTKYPFSVMWTVFIHTSNAESTQYEALVYIPDSKVEFKLA
GDIVSEADGKVTYQFRLIVPFHGISVKYDGTLNEDGNMLSGEYSLGVLRAFSLSRMPAEV
LICRPSPMELQSDKIRALWRFALTAVQEQVARRRYTWKFLAKRRDLRHRYMDLAIRTQLG
RPLNEAETKEWRKCMGALTPLEALICHHVMELRKRTICIHKGVYCDSCDAHDQEITGGRI
VCLTCDKDGGESIDLCEDCIGTEVDCAKRPDLAVPHLSTHDLYKLRSLVHQREFRSIVIM
ARNALERARTAFKDAQDVAHERTEEGGTGEAEDRLTKIVQEDLTCIKCKERVTQPCWYCI
VCEDAVFVCMKCDAGGGVSEGKHAKAHGLVRCQEEIIEKTEVSAEEKLALMVTNKLAQVD
GRFEEVDTRLSRIEQLLQAIALKMGAGQDGSS
Download sequence
Identical sequences A0A1X6MXG6 B8P213
104341.JGI105697 XP_002469765.1.31404 jgi|Pospl1|105697|fgenesh3_pg.10__5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]