SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|106760|fgenesh3_pg.54__62 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|106760|fgenesh3_pg.54__62
Domain Number - Region: 444-474
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00516
Family LIM domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|106760|fgenesh3_pg.54__62
Sequence length 504
Sequence
MSARSSILLIKDMFLPPRLPCPAGRRRIIMRAPQARLDVRECRLPPAFLPRSPCALVHHP
QPASDLIPTTPTNIPHTAPQVVRRLSGGRPISGQVDTKTGGEAGMAGVGRRGFAAAAHAA
LFLAHFEPRNGPVEHELPPSMVPGQGMDGRRANAPKFLDIASATTYGTSTLSPRSPFSQK
SPVSAGVPSPLSRTHPAALTSPSAPIVASSPTSPVGSALRHDRVVSPGMEPPKTPLSATP
TTPSAASIRLPFFEKFKDSKLRSELQPEDNLDTTAPDSDAESDYGGLAYARSSADEDEDE
DKPLKTKLPPISTSVTPASDSDHKDKVRFPSIAGSESHYSESPVSPRLPQRSLSASTGTS
TYSARTIAKSTGALDRVMETLLEDVVSPSTSAAASPAPLTAPLLPENQRDSRPPKLPTRS
HTSPTLGTGRVEQARGKKRVKERVCAKCTKIIDDGRWIQMEGGSVLCDKCWKSMYLPKVR
AAVCLVPGCETDDVVVGDSAGDAA
Download sequence
Identical sequences B8P9H2
XP_002472310.1.31404 104341.JGI106760 jgi|Pospl1|106760|fgenesh3_pg.54__62

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]