SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|106788|fgenesh3_pg.88__5 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|106788|fgenesh3_pg.88__5
Domain Number - Region: 490-512
Classification Level Classification E-value
Superfamily RING/U-box 0.04
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|106788|fgenesh3_pg.88__5
Sequence length 1148
Sequence
MATTTGGKHERRVADDEPRFTTAVPPASSRRLQSAATPSRPRKQAATAQPLRPHDAVLDV
LDTSVPDYPPPSFLEAISSPSPFFPASPISDTTVSLSDPTTAPSSPTISLSPTIAFPSQG
SPVRSPAGVHVSPDSPTPVHRTSPASRDSDSSLEIVSMEPSQLWDADRTLGLDLAERVQR
ERRRHEAANTLAPSVSTRTPRPSMPYSSNPATPTTRARTCSHCGSVRPTDSEAPSHHDSD
DEGDNPSVPGSPYSVLSHSQSRHLHDFIDTASAPTSPSSASPTRTAFTNMSSPWASNVTL
SFFGHGHKSSQGSSPPTPSLKRKESFGVRKLFALKGKEREAQDHPIDELDSWEVVESVAE
NKATSDRGTPRGRASPSPAQKARPSPPPPLAFDAPVHLPPEKLPPPVSQAPSTQAPLNPG
RREDDALDQEPLIAEQHVPGAFEIAAPKPPPPAPVSDPPLIGVVEIERRRVLKDGRTKLK
ISLLGVVVEKCGICLSQFKEGETAALGPDCQHSDTCNRHERVQPHGHRVLMISESKSDYL
PLILVNSKQEMPTSALNKTVQLDWDFIAGGVSPYILRCMAALRSSARSYQMIKSPLACTC
AGEDHTGPNVSRDRGAPKIDILEAERNKTGQVVSQSVQFALFNSDYMFYAQGDAWTVYSA
SRTRANGYRCLPRAPCPAGADVCVLQRVGARPSLMAEHRQQAASALTDVSDDMFQGLGQI
FTTLDNLQDIDPATMLFPVKMLVDYVRTNETGIGCSPAAYPTAEYIAAHMDAYSNPSLTS
WVGPGPASAGYSWPKNGLIPYCSGIRKDRSHGYTGDFNRCAYRLKGLWGGTTSRQSLARR
RALSCARKARQLRSRGRVTSELAIVMFYFALTSRRHLSCVLGPSQAIHFQRCPKHNSTYR
LVRATDRGLTPTPLRSVLPTLFQYVHESSSWFRFSHGAIHIGLAYAMCPSLGASGHVLLF
MFVLTISAALSIVPLMGLGREDYVGDSARENPRKGHRKGRRKGVEKAVGKAVGKAIGKRV
HVCERGPHGAGRVQGPRRAQDRHPEAERNKIGQVVSQSVQFAPFNSDYAFDAQGDACRAL
WELRQQAASALTDISDDMFQGLGQVFTALGKTLGKAVGKAIGKAVGKAIGKAVGKAIGKA
VGKAVEKV
Download sequence
Identical sequences B8PD66
104341.JGI106788 XP_002473635.1.31404 jgi|Pospl1|106788|fgenesh3_pg.88__5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]