SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|106932|estExt_fgenesh3_pm.C_780002 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|106932|estExt_fgenesh3_pm.C_780002
Domain Number 1 Region: 312-352
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000394
Family LIM domain 0.0072
Further Details:      
 
Domain Number 2 Region: 38-76
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000793
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 275-311
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000499
Family LIM domain 0.02
Further Details:      
 
Domain Number 4 Region: 3-36
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000476
Family LIM domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|106932|estExt_fgenesh3_pm.C_780002
Sequence length 357
Sequence
MHPFGGTPICPRCNKAVYAAEQIMGPGRKLYHKPCLACTSCGKRLDSYSLLEHDQEPYCK
NCHVKLFATRDLRLANLPNRDDVLLSPTSPPASPLRATTFLPTRTASPPVRQATAPPLPM
RRHATGGGSIDRTPFTSPSPAPPMLRPTRALSPTRSAGAEPTRSFQTAVDEQDETDEVDE
QPIRMTTGVGSTPTHTGRSAGGLPRTVPLSPVRNRFGSISSPAKPPPSDSDADVADAAEK
SGADANARLTMPLFPTSTGTRYGMALSGNGASPSTGKQWGGGTPVCPKCGKTVYFAEQVK
AIGKTYHKGCLRCTECKTSLDSTRLTERDGHPYCHRCYGKLYGPQGSGYALLGKAGG
Download sequence
Identical sequences A0A1X6MNA3
jgi|Pospl1|106932|estExt_fgenesh3_pm.C_780002 104341.JGI106932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]