SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|107013|estExt_fgenesh3_pm.C_1650010 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|107013|estExt_fgenesh3_pm.C_1650010
Domain Number 1 Region: 563-768,845-1173
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-55
Family RNA helicase 0.04
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|107013|estExt_fgenesh3_pm.C_1650010
Domain Number - Region: 117-151
Classification Level Classification E-value
Superfamily UBA-like 0.000252
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|107013|estExt_fgenesh3_pm.C_1650010
Sequence length 1395
Sequence
MAKKKKTQLKPVVRGFATTSIPKKVVQPSEEERAEEPTTATTEDSPPAKDEGTPSQVDKT
DASTDNAGTPEEQASQSMIDKYQDKTEREVRCVLVKTTVNGTEEKALARLAITYGVLRRL
GFQEDRVEECIRAINGVDLEEAADWLHLHCSLDELGMHQDTSDAKSLPVFPFKCVNNSIG
DPDQEGCTKNWPPRRKCPGLCAFGLHEGIETPSSSSDRVASTVSSSGSHSPVDDPNIEYV
RVKMQISELTTHRQMDEQRDAAFLQSLKRRLEDIRQDYLFDATEAEAQFRIERQKSHAQL
LQSRLRGAADKSAAAPTSEPPKPYEDGSPDGLFAMLEEMPATEVTDEGTTISVRDMALPK
HWSGRTPKALLHERVHKVDRFAIVTYRDISGTSRAKRAALEIRWQDGKAGAWSMDNVACH
DQFQAEQYISTVALHALSFPSSEGFALGSTSVTSSQTSFRLLPAIYRDLWDELEKGRLNQ
DEATNRAIWAKLRAILEPKLTASNKVVYPLIQSKNTGSALDAKAGNAFQSAYRNSDDLSP
EQISAGFQARASSSAYQEMLQHREQLPIAKYRNEIMSILEMSQILVLSGETGCGKSTQVP
AFILEDQLAKGRHCKIYCTEPRRISAISLAQRVSRELGEPAGAVGTPSSIVGYSIRLESN
INSRTRLAYVTNGIALRMLEGGSGQGGQGTAFDEITHIIIDEVHERTIESDFLLIVLKSL
LQERPDLKVVLMSATVDAEKISNYFGGTPILKVPGRTFPVDVRFLEDAIELTKWKVTENS
PYARRGKDKFNRGKGRIEWSEDVAAGDDDDEGDQQENVKLEKRYSPNTASTINTLDERLV
PYDLIVRLLEHICFEDLAYANYSQAVLIFMPGMGEIRKLNDLLMEHPQFNSEETFKIYPL
HSMISSEHQGAVFDIPPPGVRKIVIATNIAETGITIPDITCVIDTGRQREMRFDEKRQIS
RLVETFVAKSNAAQRRGRAGRVQSGLCFHLFTKLRHDTKMAAHPDPEMMRLSLSDLALRI
KIMKVKLGSSIEDVLSKALDPPLAVNIQRAVSALVEVRALTPSEDITPMGRLLSKLPTDV
HLGKFLLIASLFRCLDPALTIAATLNAKSPFISPLGHEQEADRAKGSFRVGLENSDFLTI
HNAFASWRQACANGIGRKFCKTNFLSYQNLQQIEELRQQFLGYLVDSSFIRVDNSFVREL
SRARYGRGRTRFVPVPPELEVNTGNAFMLNAALAAGLFPKLLSIDPTTGDMKTVSNNQVA
SFHPSSVNFGKRAREFGVNYLSYFTLMHSKKLYAWETGPVDDVAMLLLCGEAEFKLMSDI
VYVDRKIKFRVQPRSGIALKILRNHLADLLSTQMRIKPLTESQTLWDDVAMMVLGKVKPR
EPGEYQENITLVVNR
Download sequence
Identical sequences 104341.JGI107013 jgi|Pospl1|107013|estExt_fgenesh3_pm.C_1650010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]