SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|107073|estExt_fgenesh3_pm.C_2240003 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|107073|estExt_fgenesh3_pm.C_2240003
Domain Number 1 Region: 177-228
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000742
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 2 Region: 24-107
Classification Level Classification E-value
Superfamily RING/U-box 0.000000294
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|107073|estExt_fgenesh3_pm.C_2240003
Domain Number - Region: 114-169
Classification Level Classification E-value
Superfamily RING/U-box 0.0343
Family IBR domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|107073|estExt_fgenesh3_pm.C_2240003
Sequence length 398
Sequence
MEWVQLRLQEEPSAQAADQGEEDEENSIECGCCFSIYPFEKMIQCPEAHLFCTDCIISYA
STLLGSHDARIACMDQSGCKELFPESELRRVLPPKLVGLYDRVCQRRDIEAAGLENLEEC
PFCEYKCVIDNPQEKLFRCENADCMAVTCRECKKADHLPRSCKEVEEDKKLDVRHAIEEA
MTRALMRNCPKCSKAFIKEQGCNKMTCPNCATMSCYICRKVVTGYDHFGNPPPYTGQANP
KKCQLWDPVEQRHSEEVTAAAKKAVEEFKRSHPELADEDLHVDLPPPPVAGPSNAARPVA
VAGAPPNVVRNPIAAAAHYGRQLANVFLGDPLQAPPVGGAVYNLHVNFNAPQVYPGIPAI
GMPAVGVGPVVPPPIPQPPRPARPAARAPRRARARRKA
Download sequence
Identical sequences jgi|Pospl1|107073|estExt_fgenesh3_pm.C_2240003 104341.JGI107073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]