SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|107327|estExt_fgenesh3_pm.C_160003 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|107327|estExt_fgenesh3_pm.C_160003
Domain Number 1 Region: 72-143
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000000636
Family Splicing factor U2AF subunits 0.0032
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|107327|estExt_fgenesh3_pm.C_160003
Domain Number - Region: 16-38
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00209
Family CCCH zinc finger 0.0067
Further Details:      
 
Domain Number - Region: 145-166
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00301
Family CCCH zinc finger 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|107327|estExt_fgenesh3_pm.C_160003
Sequence length 230
Sequence
MASHLANIFGTEQDRVNCSFYYKIGACRHGDRCSRKHIKPAFSQTILLPNVYHNPAHDPV
CKLTEKELQEGFDAVYEDLYCELAKFGHLLELHVCDNVGDHLIGNVYARYEWETEAQTAV
DNLNDRWYAGRPLYAELSPVTDFREACCRQNENGECNRGGFCNFMHLRLASKDLVSSLRH
GQRLERRMHPPKVEGGGGWEPSRKESVKGRSASPSKRGGRNEGEDRWTRK
Download sequence
Identical sequences A0A1X6NCF8
104341.JGI107327 jgi|Pospl1|107327|estExt_fgenesh3_pm.C_160003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]