SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|108169|estExt_fgenesh3_pm.C_1270002 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|108169|estExt_fgenesh3_pm.C_1270002
Domain Number 1 Region: 251-321,351-578,633-742
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.14e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0012
Further Details:      
 
Domain Number 2 Region: 114-214
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-28
Family Zf-UBP 0.00014
Further Details:      
 
Domain Number 3 Region: 585-649
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000234
Family UBA domain 0.0036
Further Details:      
 
Domain Number 4 Region: 1-80
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000965
Family Zf-UBP 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|108169|estExt_fgenesh3_pm.C_1270002
Sequence length 743
Sequence
MVTCGHLVEIARLQLPKLSQSVHREECTQCFDTQDHPLGIDVCLTCFNGGCLGKERHHAR
THVHKTGHGFSLNIKRKLKPSANRVDEEEPPAKMTKLAIVEDRDEDKYEYKTVLKCWKCE
PENGLEIPDAMADPHENLWLCLTCGSLGCGRQQYGGLGGNGHGLQHYEETRHPISVKLGT
ITPEGNADIYCYICNDAKQDPELAAHLATFGINVQTQTKTEKSMTELQIEHNLKFDFSLT
DESGKALEPVFGPGLTGLSNLGNSCYMASVLQTVFSLSVFRQRYYPSASAHWETCTETLP
ASCVDCQMHKLADGLLSGRYSHPRPTSSGASRLKETNPLAHDSPTPIFQEGVRPSGFKAL
IGKGHEEFSTMRQQDSEEFFTHLLTVLRRHAKKTSGMPNHDPTEVFAFGMEQRLECGECH
RVRYRVDGTDVVSVPVPARETGKDAEGRTQYAEVALGECLDILTGTEALEYTCPGCQKRV
IATKRSRFATFPQVLMVHAKKFQLVNWVPTKLDIPLNVSDTLQLDQYLGRGLQPGEQKLP
DDTAGTRTGAPPLEAMGFPTIRCQKALLATGNNDAEAAMEWLFAHMEDPDIDAPIQAAGS
GSSAPEPSQEQVSMLSEMGFTHAQARKALRETGGDAERAVEWLFSHPDDNGEDAAPSGSS
ETPESSGTGGSAELPARYRLKAFISHKGPSVHSGHYVAHIRVEDAAVGGESWVLFNDEKV
VKADEESVRELKKLAYLYVYERE
Download sequence
Identical sequences 104341.JGI108169 jgi|Pospl1|108169|estExt_fgenesh3_pm.C_1270002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]