SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|108741|estExt_Genewise1Plus.C_10207 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|108741|estExt_Genewise1Plus.C_10207
Domain Number 1 Region: 169-498
Classification Level Classification E-value
Superfamily Cysteine proteinases 8.44e-80
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000435
Further Details:      
 
Domain Number 2 Region: 11-117
Classification Level Classification E-value
Superfamily RING/U-box 2.83e-16
Family Zf-UBP 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|108741|estExt_Genewise1Plus.C_10207
Sequence length 545
Sequence
MSQMPDNASGTCPHIAESSLEPLHISHKFKSMAVWNLRYSHSITRPAKRRKLAAPTCGTC
DSPLPRPFACLRCSYSGCWRDGHVKRHLEETGHTLCVDVKTGSIFCSECGDFVYDSGVNS
MFAAATITTEEKNTSFRDGTRCREPFRSWSPNTKETAALELSVPAACYGRRGLLNLGQTC
FMNAILQSFAVNPLLRHYFLSDKHNYQLCKNEACICCEMDKFFTEVFSENTTPYGPTSFL
ATTWQASPDLSGYAQQDAHEFFMHALNEIHTKTRGSTKLHCICIVHSAFAGQLQSDVKCE
RCGNVTTATDPMFDISLELQDKSLGQAGQELTLASCLRKFTQPEKLGPNQYSCAKCGKAS
HASSISDLSFIRKLPPVLSFQFKRFEHKAGDKSAAHKIEAPVRFPSIINMAPFTSAVMDM
KDREAKGSGTEFPGPRAMYEYDLFSVVCHEGQINNGHYTCFARSRDEWYRFDDDKVTHSS
LGACLGSQSQAYMCFYVKRHLDYEPYVTPSYKVTREAEAVKERERERKKEAARMREVEDD
LLAMV
Download sequence
Identical sequences jgi|Pospl1|108741|estExt_Genewise1Plus.C_10207 104341.JGI108741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]