SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|110539|estExt_Genewise1Plus.C_220025 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|110539|estExt_Genewise1Plus.C_220025
Domain Number 1 Region: 249-280
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000612
Family CCCH zinc finger 0.0064
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|110539|estExt_Genewise1Plus.C_220025
Domain Number - Region: 175-199
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000432
Family CCCH zinc finger 0.0037
Further Details:      
 
Domain Number - Region: 228-252
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0419
Family CCCH zinc finger 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|110539|estExt_Genewise1Plus.C_220025
Sequence length 400
Sequence
MDPSTSAAALKLEIARLKGMINQHKTSEPPARSTGHPAGHPASRPPRSNVYVNPNYKPPS
KSTTPVPSTVHPPRLPVPSSSQKRDVVIGGVAFESSGRSLVRKDLNKPSSVGDSKPPRRP
VPPITLARNKAGTLVNPNRTYKPKVSRGRARNMTLNNSHRPYQGRRVSSKRKVNKPCARF
TTTGACNRGLTCMYQHDPTKIAICWNFLQGNCPNTAETCALSHDPTPERTPLCVHFANNG
RCHRANCPFPHVRVGKREGVCRDFAVLGYCEKGLDCDKQHVRECPDFAEKGECTTKGCKL
PHVIRANRNRKAASSAGSKDASAGQTSLRADASVSSNSATADASSSHPVTAEEAQLGDEF
ISLTFHESGSDDDSDEDDDDESDDDEEDANEEVIETHDSE
Download sequence
Identical sequences jgi|Pospl1|110539|estExt_Genewise1Plus.C_220025 104341.JGI110539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]