SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|110970|estExt_Genewise1Plus.C_160051 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|110970|estExt_Genewise1Plus.C_160051
Domain Number 1 Region: 6-102
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000541
Family TFIIH domain 0.0067
Further Details:      
 
Domain Number 2 Region: 156-198
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000419
Family BSD domain 0.0055
Further Details:      
 
Domain Number 3 Region: 219-270
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000124
Family BSD domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|110970|estExt_Genewise1Plus.C_160051
Sequence length 599
Sequence
MPPLCTAKVSYKKALGLLELTSTHLQWTQDGKKAPTVRVPHAEAASLFCSKEGASQVRLK
LGLVGDDAGHNFTFTSPQPVALVEREKFKAELTNIISRNRSGVSTPTLHAPGTPTVPTSI
NAASSKIPVTAARTPHSRAASVAGDGRASATPVSDPTSEFRLRKKVLLGNPELAALHREL
VMGGHITENEFWEGREHLILAQAAAEIQRRGKPGQLVDPRPQTVDGEVKIVITPQLVHDI
FEEFPVVAKAYSDNVPRKLSEAEFWKRYFQSRLFNAHRASIRSSAAQHVVKDDPILDKYL
EREDDELEPQRLREEGVDIFIDLGATQEDHEETGNIRDVTMQPGKQRAVLPLIRKFNEHS
GRLLQSSLGEPAAKRRRTDNGEASDHLLQLDLEDLRDNQATAGILLDMQDRQRYFESGTS
SSTAQASVGETVDANAVLNEVKHSLQGWFGNLKSLRIERKAGEAALQEMTRNVSGRLEVK
TQKNDIPDALFRQMTTCQTAANEFLRQFWLSIYPPLTEVQTLASATSAQKAAKAAKMVGY
LGKTPEKVAALIHAAREEGVDPARVQVAMKPILDAVDKALTFWRDRNAKTVNAPVARGR
Download sequence
Identical sequences 104341.JGI110970 jgi|Pospl1|110970|estExt_Genewise1Plus.C_160051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]