SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|111298|estExt_Genewise1Plus.C_300080 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|111298|estExt_Genewise1Plus.C_300080
Domain Number 1 Region: 27-99
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.76e-19
Family Ubiquitin-related 0.0011
Further Details:      
 
Domain Number 2 Region: 356-399
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000681
Family UBA domain 0.0033
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|111298|estExt_Genewise1Plus.C_300080
Domain Number - Region: 147-192
Classification Level Classification E-value
Superfamily XPC-binding domain 0.0144
Family XPC-binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|111298|estExt_Genewise1Plus.C_300080
Sequence length 402
Sequence
MSKVPSLLSLTLYHGFSNSPSGPNELKLQITIATDKSVADLKQAIAEKSDVPADRQRLIY
SGRVLKDEDVLSTYKIQSSHTVHMVKGAARAAASSSQSATPQALPTMQAGQNPHDPLTQL
NGHMGYGLMAGLNPFAEMGLNPNDPNMMQSMLNNPQFLQQMSGVMSNPAILDQIFASNPQ
LQAMAPQVRQVFQSEQFRQMISNPETLRTMLQMSSLMRGGDTGLGAPAFPAPGLPSTARQ
GQQDAGTGASPAGAAPPPLFNPFFPPPPAAGSTTEAGSGVPPTSPGAAGAGAGMFDPALM
QQMLAAMGGGGGAGGAGAGAGADPFGLGGLGALGGLGGGLGGLGGVPAAPTDARPPEERF
QVQLQQLQDMGFTNASQNVRALLATGGNVHAAIEYILNGGGL
Download sequence
Identical sequences jgi|Pospl1|111298|estExt_Genewise1Plus.C_300080 104341.JGI111298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]