SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|111846|estExt_Genewise1Plus.C_50180 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|111846|estExt_Genewise1Plus.C_50180
Domain Number 1 Region: 204-343
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.88e-22
Family UBX domain 0.018
Further Details:      
 
Domain Number 2 Region: 6-44
Classification Level Classification E-value
Superfamily UBA-like 0.000000379
Family UBA domain 0.007
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|111846|estExt_Genewise1Plus.C_50180
Domain Number - Region: 98-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0417
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|111846|estExt_Genewise1Plus.C_50180
Sequence length 345
Sequence
MSDKDVLLQMGFDPARVEWAIKATGGRGLQPAMDHILENEGKPVPDLSSVSSSSASSGPG
AESTGQAIDENDEDMEALKAVYGSAGAGAAAVADVEAKSIKCSVCGKIFKNTALANYHAE
KSGHDQFEESTEEIKPLTEEEKKQKLAELREKMSEKRAVKAQQEARENLANETIRRKAGK
DMNELREEIRAKEMKKEAEAKRREKVEDAKARAAIKAQIEADKRERAAKAAREKALREGK
PLPGSSTPSTAAAPAVAAPKAASKDYAETRLQIRMASGGQPYTTTLPSDSTLRAVAEFLA
GQTLAVDVETVTFAQHFPRKTFTRDDFSRTLRDLGLTPSAVLIAS
Download sequence
Identical sequences A0A1X6N6R5
104341.JGI111846 jgi|Pospl1|111846|estExt_Genewise1Plus.C_50180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]