SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|112482|estExt_Genewise1Plus.C_650052 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|112482|estExt_Genewise1Plus.C_650052
Domain Number 1 Region: 3-149
Classification Level Classification E-value
Superfamily UBC-like 5.93e-51
Family UBC-related 0.0000052
Further Details:      
 
Domain Number 2 Region: 167-219
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000185
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|112482|estExt_Genewise1Plus.C_650052
Sequence length 221
Sequence
MDARLRRVNKEISDCKNDKSSNISIDLVDNSPFHLIGEFDGPEGTPYEGGHFKVDIIIPE
SYPFQPVKMKFITKVYHPNVSSASGAICLDILKDAWSPVLTLKSTLISLQSLLCSPEPRD
PQDAEVAKHYMTSKSSFEETARYWTQAYAGGSGKEVRGKGRADGPRDEIAMAGLERAHVE
KFQAMGFDRTKVIDVLRRLNYRGANVAQINDDKVVDELIKS
Download sequence
Identical sequences A0A1X6MLT1
104341.JGI112482 jgi|Pospl1|112482|estExt_Genewise1Plus.C_650052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]