SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|112568|estExt_Genewise1Plus.C_1210114 from Postia placenta

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Pospl1|112568|estExt_Genewise1Plus.C_1210114
Domain Number - Region: 160-193
Classification Level Classification E-value
Superfamily UBA-like 0.0155
Family UBA domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|112568|estExt_Genewise1Plus.C_1210114
Sequence length 198
Sequence
MSATIEEIHSDHSEHEHEHEHDHDHDHDHEEDPTSQAALDKIQSRSERKARKALLGLGLK
KVQGITRVTLRRPKNVLFVIAAPDVYKSPNSDCYIVFGEAKIEDMNSQAQLSAAQQLASG
AGAGVPNLESSVAGGDHDDDDIPELEAVKEEGPVDESGVDPKDIELVIQQVGCSRAKAVR
VLKESGGDLINAIMAASE
Download sequence
Identical sequences jgi|Pospl1|112568|estExt_Genewise1Plus.C_1210114 104341.JGI112568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]