SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|113351|estExt_Genewise1Plus.C_610035 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|113351|estExt_Genewise1Plus.C_610035
Domain Number 1 Region: 328-522
Classification Level Classification E-value
Superfamily NTF2-like 1.42e-34
Family NTF2-like 0.00066
Further Details:      
 
Domain Number 2 Region: 176-285
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000442
Family mRNA export factor tap 0.06
Further Details:      
 
Domain Number 3 Region: 551-605
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000561
Family TAP-C domain-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|113351|estExt_Genewise1Plus.C_610035
Sequence length 606
Sequence
MSSATTSATTSTTSNRATRAIAANALRGAGLMDRDTRMRDVSDKPGGRKGSAAKTIQHKN
RSSHRPRPIDALTGKDQGSSSANAKAAMLASRIAGGESIAIRGAARGPLGRLRRNAVSNG
DVVVERKVVDLWREFVHRRWNPEHKFLNLERIAEDEFVRQHRLLPGSGASGAGKEIAVLF
KLASMLQPKVETISLAHNGLTSGSSLSRLSHYLPGVVNLSLQDNKLSTWRDIDYISSKRG
RLQQLRELIMVENPLRDMEYSNNRIDRYKSEMVRRFPSLDILDMEAIPKIGFDAPAASTS
AVASTSQATATTFPAEMGLSFITGVDSSVVSNFLVRFFPLFDNQRAGLLDVYHPNATFSF
SSNTTIPARARIEGYHYSKEMPNQRKLEWTPWLTGGHGGSRNLNRMGGGIDKMTKTLHVG
SEAAVKAMADLPITKHDITGSPEKFCVDAWPVQAGDSPQLFVTIHGQFTEEPSLGIRSFD
RSFILAPAPEGSRARQTGWDVVILSDQLTVRAYSNHEAWTPGPMRVQAGEPMASGSSLQP
PANPQIQAALSAMPEPQRSLVMEVLTRTGLNLEYAVQCLESNAWDVGRAVANFEQVKGTL
PQDAFL
Download sequence
Identical sequences jgi|Pospl1|113351|estExt_Genewise1Plus.C_610035 104341.JGI113351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]