SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|113586|estExt_Genewise1Plus.C_360035 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|113586|estExt_Genewise1Plus.C_360035
Domain Number 1 Region: 228-290,508-687
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.08e-57
Family Tandem AAA-ATPase domain 0.00016
Further Details:      
 
Domain Number 2 Region: 85-287,319-359
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.51e-50
Family Tandem AAA-ATPase domain 0.00012
Further Details:      
 
Domain Number 3 Region: 428-487
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000596
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|113586|estExt_Genewise1Plus.C_360035
Sequence length 688
Sequence
MLQNLIKDTSKTDSTSWAQTQKRRREQRRQARLEKSQISQEEARLRYKLGRKLTYAEKST
LALHRNHPDLKDVWGDLEKGVAIVEPQKADPPLGLKVTLLPFQLESLFWMRKQEEGTWKG
GILADEMGMGKTIQMIAMLVSNAGIKPNLVVAPTVAIMQWRNEIQAHTDGLKVLVWHGAS
RETDIKQMRKFDVVLTTYAVLESCFRKQENGFKRKGKIIKEKSLVHTIHWQRIILDEAHN
IKERSTNTAKATFELQGNYRWCLSGTPLQNRVGELYSLVRFLGGDPFSYYFCKSCNCKSL
HWKFSDKRSCDDCGHSPMKHTCLWNNEILTPIQKNGMVGPGETAFKKLKILLDRMMLRRT
KIQKADDLGLPPRTVVVRRDYFSPEEKELYLSLFSDAKRQFTTYVDSGTILNNYSNIFSL
KTNAGAFSKEEFGETTVCRICNDIAEDAIQARCRHIFDRECIKQYLNTAIEATPACPVCH
LPLTIDLEAPALELEENAKPRQGILGRLDLDKWRSSSKIEALIEELTNLRKQDTTTKSLV
FSQFVNFLDLIAYRLQKAGFTICRLEGTMSPQARDATIQHFMNNVNVTVFLVSLKAGGVA
LNLTEASRVFLMDSWWNPAVEYQAMDRIHRLGQHRPVQVVKLVIEDSIESRIVQLQEKKA
AMVDATLSTDDSAMGRLTPDDLGFLFRL
Download sequence
Identical sequences jgi|Pospl1|113586|estExt_Genewise1Plus.C_360035 104341.JGI113586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]