SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114030|estExt_Genewise1Plus.C_90013 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114030|estExt_Genewise1Plus.C_90013
Domain Number 1 Region: 485-571
Classification Level Classification E-value
Superfamily Homeodomain-like 1.97e-25
Family SWIRM domain 0.00073
Further Details:      
 
Domain Number 2 Region: 106-160
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000218
Family Homeodomain 0.0088
Further Details:      
 
Domain Number 3 Region: 45-102
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000977
Family ZZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114030|estExt_Genewise1Plus.C_90013
Sequence length 635
Sequence
MTVTHRKRQYQPEEIQSECSWSSCCCASSHAPFLRKWYVPAVNEPGLQIQCDGCGCDLTH
SIRIKCADPVCELGDGVDICPACFCSGKEFGRHKRCHEYRVVELHSYPIFSEDWGADEEL
LLLEGISLQGLGNWQAIAEHVGTRTKEEVEQHYRSVYIDSPDWPLPRMDLHFEVDPAVFQ
ERKRRRISNMNTNPPPPPKLAPTSAPGVHEIATFLPGRLEFEHELDNEAEDLVKDLEFGI
CLEWGGDEIPEDENDPDVRARARWEEEQKMKDGTPGKRLPNGYLNGSPNGHHANGDSPSR
DTRGRSEDGSKADNGATDGEADAEELTQPPPIETLDSLSFKLSLVEMYNQRMDKRQENKA
IMFDRGLLNYKQMQAADKKRPKEEKDIIHRLRPFARLMTAEDFEVFSADILYEAMLRKRI
QELQHYRRMGLTTAADIEKYEADVLKRLRAGSARQSSGPERSERGKSHDDRETTPKATPA
VIGTGPPGRKMPAPLNLANSPLLHLLTPEEQTLCSQLRILPKPYLVIKETLVREYARRGG
KLRRREARDLVKIDVNKTSRVWDFLVQAGFLKVGAAEPPPANQDRPSATPSLSASPSKES
HALVSPRPPPFTTAPLGMSSTFSSSSINSTLPNVG
Download sequence
Identical sequences 104341.JGI114030 jgi|Pospl1|114030|estExt_Genewise1Plus.C_90013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]