SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114044|estExt_Genewise1Plus.C_90057 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114044|estExt_Genewise1Plus.C_90057
Domain Number 1 Region: 155-372
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.21e-64
Family Protein kinases, catalytic subunit 0.00005
Further Details:      
 
Domain Number 2 Region: 21-143
Classification Level Classification E-value
Superfamily SMAD/FHA domain 4.97e-22
Family FHA domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114044|estExt_Genewise1Plus.C_90057
Sequence length 372
Sequence
MMQPPANPAEDVMATDLPAAETQSTQQETQPASQTENILEEHLWGCLLPCSPLCRRVDFQ
KIKRTYLVGRNQEQRPGGNDIILPGKKISNYHCKIEWDGREERQAAVRVTDTSSNGTFIN
GVRIGKGRSMLVYEGNEIAFGTSQPQDNPAEDYRFVYRHMAAGTPPTGLHAHYQMHQELG
KGSFATVLKAMHREDGEWFAVKVMQRNRLRSPVGNSTAGSPSFAREISILEELQHPNICQ
LKEVFYEDHTKGSICGVDLVLEYIDGGDLLDYIVRRGHLTEPQAQYLTYQICDALAYIHS
KNIAHRDLKPENVLLTSTNPPQVKVADFGLAKAVDSLTMLRTMCGTPCYLAPEVVLQESN
NGYDQVVDSWSV
Download sequence
Identical sequences 104341.JGI114044 jgi|Pospl1|114044|estExt_Genewise1Plus.C_90057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]