SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|114651|estExt_Genewise1Plus.C_1180016 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|114651|estExt_Genewise1Plus.C_1180016
Domain Number 1 Region: 746-819,952-1114
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.08e-58
Family Tandem AAA-ATPase domain 0.00026
Further Details:      
 
Domain Number 2 Region: 393-432,488-529,560-737
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.21e-39
Family Tandem AAA-ATPase domain 0.0004
Further Details:      
 
Domain Number 3 Region: 860-916
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000103
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|114651|estExt_Genewise1Plus.C_1180016
Sequence length 1132
Sequence
MSGPRPSAFFTGSDEDEPDNDVTMDTEERSSLPKPGPPVNDQALFFADSDDEDAGDATLP
QVSFAGDDLLAAVSVDEADDVSIPDFNDAPRASSVSSTYSTNEPRTSSPVPSVNSAERPT
KKRRLSSEPKVPSPAAFTSVYLGSFLVANAWSTVRGSGYVKAGDEIRIERDTPEDPTPPE
SKRTKSKDVKGKSGKKQLSIATMFKPQPAKPSKKKQDTVVRLTNTRGFEFGRLPQDVASW
ASKLLDMDIVDFRGSTVVDCSTTLHSGADIIVSLSVYIKASAFQVLRTSSDEKARVMFNE
GQETASEQMLRERKHSLLSLFDVLDLKPRRGSSFTRKPHGELDGKDLEVLTQRRASTNEK
KVMKKEIVGDGEEVEVEADGEDLSENELSLIYKRAQENDQKLGEMDPANSFTLNLRPYQK
QALLWMHSIETGATSAREGSSLHPLWKEYVFPLEPKDGIIDLTADEKAFYFNEYSGELSL
EFPKAERKCRSGILAWKLTYPLAVGMGKTIMLSALIQTACGPEEPTPEPDTGRISKKRQL
KLNNAFQARNKVEKRPRRGPSATLIVAPTSLLSQWSEELGRSSKPGTLKVLVWHSQNRID
LDTILDCDDPVDVVITSYGTLVSEHSKSEKSGGGVMPPVFETEWLRVILDEAHHCKSRQS
KTARAVYALRARRRWAVTGTPIVNRLEDLYSLLKFLDFTPWSNYTFFRSFITLPFLARDP
KAVEVVQIILESVLLRRTKDMRDTDGKKIVELPSKEIVVESLEFSPLERKIYDSLYSDAK
KNFEQLNEKGLISRNYTHILAMLMRLRRAVLHPNLVLTTASDLKQPSGDGEVNVQTLIKR
FGEGDDSAGDNKVFAEGVLANLDEEEERECPICFDVMDTPTIIPNCMHQCCKDCIVAYIE
TCRGKGEDGRCPTCARGPVKEGDLLEVVRTKQELPEDGSAAGQSSPPTIILRRNDFRSST
KLEALLQNLRHLREQDPCFRAVVFSQFTSFLDLIQTVLEREHLPWFRFDGSMDIKKRNEA
VSEFKEPSKQPKVLIVSLKAGGVGLNLTNANHVFMMDCWWNAATENQAIDRVHRIGQERP
VYVKHFIISGTIEGRILQIQKRKAAIVKEAFRGKGEGDPESVENLRIMFGDD
Download sequence
Identical sequences 104341.JGI114651 jgi|Pospl1|114651|estExt_Genewise1Plus.C_1180016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]