SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|115485|estExt_Genewise1Plus.C_40072 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|115485|estExt_Genewise1Plus.C_40072
Domain Number 1 Region: 502-526
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000034
Family CCCH zinc finger 0.0026
Further Details:      
 
Domain Number 2 Region: 790-869
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000589
Family Smr domain 0.0072
Further Details:      
 
Weak hits

Sequence:  jgi|Pospl1|115485|estExt_Genewise1Plus.C_40072
Domain Number - Region: 480-501
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00837
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|115485|estExt_Genewise1Plus.C_40072
Sequence length 876
Sequence
MLAPPIISIPAPSSDISDSGSLSGHDSAAQPKFPHTRAQLSAIARQYRSVDAYDHDADGD
DLRVNAALVGRVAVLLDNEREDDLKALLKETFGHIDEEELEQHVLDLMHKHRDDVDNVPF
MFLTPTRRPISRPSSRASSHSARLIARPDTPNSAPSSPLAMIFRRPHTPVTSPLVQTQAS
SYITARSDSPSNSPLITTVQFVSSLPASPIGSPRSLNAKANEFRPIPRPLSAASSHPASL
SQLRAETPSPDMWAHNPQRPTSKLAIAAPLTPDSALLPRALTPSSSLRSSMRPDDQSDEE
DPFDPFAASNIPRSFHPVAGEFDAQWPTPPLSGSSPSQDGPHVSGDAPYGVIGQAPPPPE
GEDMDPEAAAMLTDGMTPFDVLSSVFGATLAPSELEEALATNGYDFEKAMTWLVDRSMTA
SPPTNGPIRIQSMGNRVMMVSRDGGNGMVRGGRGGYNNPNTPGMRYGQRFVNGRPVPGGN
RVCRYFLAGECLRADCRFSHDLERALCRFWLRGTCAKGENCEFLHHLPKDIDVSTLTHAM
ARTDINAAPLEHARSASPDEFPSLNYAADAGRNGRGGYRYGRDNGYHDPGRTRFATAVKR
PAPAPVPTSPQVQSPKDPALIMARREAMGVAAEPLHQTSVVAPKPSPRLKLRPPTLLPTL
PTGESVSQLYMAYRSRALRLGAARNACLSRAADAWRRGDGAAAKRFSREGHDLNAKMSAE
MVEAAGKLVRERARLAEQAVRVRDSGWSDDYGDRTARGRISGAGLGVCLGIASQNVNGEN
KLTPEERTEVLLDLHGLHAAEAAEILEEFLLALEREHFYGLAYLVVGEEKHTGSQDPARG
ASRVRLAAGVREWLHLWGYPWSERDGVICVDALTHQ
Download sequence
Identical sequences jgi|Pospl1|115485|estExt_Genewise1Plus.C_40072 104341.JGI115485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]