SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Pospl1|115888|estExt_Genewise1Plus.C_1550069 from Postia placenta

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Pospl1|115888|estExt_Genewise1Plus.C_1550069
Domain Number 1 Region: 459-527,616-791
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-53
Family Tandem AAA-ATPase domain 0.00036
Further Details:      
 
Domain Number 2 Region: 174-377,409-449
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.27e-49
Family Tandem AAA-ATPase domain 0.0001
Further Details:      
 
Domain Number 3 Region: 537-598
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000884
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Pospl1|115888|estExt_Genewise1Plus.C_1550069
Sequence length 793
Sequence
MLQAAIQDSLDTARFNESRNVGMSSAGAGSSKTRLPVDSDTALRAAAAAVAERRLANDRE
QSHDNSDVDDSDALSLSSDDVPMAGKGASKMLQNLIKDTSKTDSTSWAQTQKRRREQRRQ
ARLEKSQISQEEERLRYKLGRKLTYAEKSTLALHRNHPDLKDVWGDLEKGVAIIEPQKAD
PPLGLKVTLLPFQLESLFWMRKQEEGTWKGGILADEMGMGKTIQMIAMLVSNPGIKPNLV
VAPTVAIMQWRNEIQAHTDGLKVLVWHGASRETDIKQMRKFDVVLTTYAVLESCFRKQEN
GFKRKGKIIKEKSLVHTIHWQRIILDEAHNIKERSTNTAKATFELQGNYRWCLSGTPLQN
RVGELYSLVRFLGGDPFSYYFCKSCNCKSLHWKFSDKRSCDDCGHSPMKHTCLWNNEILT
PIQKNGMVGPGETAFKKLKILLDRMMLRRTKIQKADDLGLPPRTVVVRRDYFSPEEKELY
LSLFSDAKRQFTTYVDSGTILNNYSNIFSLLTRMRQMACHPDLVLKSKTNAGAFSKEEFG
ETTVCRICNDIAEDAIQARCRHIFDRECIKQYLNTAIEATPACPVCHLPLTIDLEAPALE
LEENAKPRQGILGRLDLDKWRSSSKIEALIEELTNLRKQDTTTKSLVFSQFVNFLDLIAY
RLQKAGFTICRLEGTMSPQARDATIQHFMNNVNVTVFLVSLKAGGVALNLTEASRVFLMD
SWWNPAVRLLQYAMDRIHRLGQHRPVQVVKLVIEDSIESRIVQLQEKKAAMVDATLSTDD
SAMGRLTPDDVRL
Download sequence
Identical sequences jgi|Pospl1|115888|estExt_Genewise1Plus.C_1550069 104341.JGI115888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]